KEGG   Desulfobacca acetoxidans: Desac_0274Help
Entry
Desac_0274        CDS       T01454                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dao  Desulfobacca acetoxidans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Desac_0274
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Desac_0274
Enzymes [BR:dao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Desac_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
339606..340625
Genome map
AA seq 339 aa AA seqDB search
MTKPWGQMLMVGIPGLHLDEVARTLIRDLQVGGIILFKRNISHPQQVAELIDACQQTALA
ASGYPLLVAVDQEGGPVQRFRHPWLETPSARQMGAAGDLAAIEHSAQRVAQELQLMGVNV
NLAPVLDVARNPDCPLWERSYSADPEAVVRCGLAAVRGYLAGGVLPVVKHFPGLGATRLD
SHLDLPTVEGGTDAGNEDLFPFREAITAGIPAVMCAHLLVPSWDSNLPTSLSPVAVTRIL
RQHLKFFGLIFSDDLEMGAITRKWPVPEAARRAVAAGIDIILICEQIENVKKTLAALSQS
PELESRLRSAWQRIQQYKKTLPQLRLNLEAIQARFASGH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagccttggggacaaatgctcatggttggcattccgggcctccacctggatgaa
gttgcccgaactctcatccgtgatctgcaggtagggggaattatcctttttaaacgcaac
atctcccatcctcagcaggtagccgagctcatcgacgcctgccagcagacggcgctggcc
gccagcgggtatcccctcctggtggcggtagaccaggaaggagggccggtacagcggttt
cggcacccctggctggagactccttcagctcgtcaaatgggcgccgccggagatctggcc
gcgatagaacatagcgctcaacgtgttgctcaagagctgcagttgatgggtgtcaacgtc
aacctggcaccggtattagacgtcgcccggaatccggattgccccttgtgggaacgttct
tatagtgctgatcccgaggcagtggtgcgttgcggtctggctgcagtcagaggatacctg
gctggaggggttttgccggtagtcaaacacttccctggactgggcgctaccagacttgac
tcgcatcttgatctgcccacggtcgaaggcggaaccgatgccggaaatgaagatctcttc
ccgtttcgggaggcgatcaccgctggcattccggcggtgatgtgtgcccatttgctcgtc
ccctcctgggacagcaatctaccgacttctctatcgccggtagcagtcacacgcatcctg
cggcagcatctaaagttcttcggcctgattttttccgatgatctggaaatgggggctatc
acgagaaaatggccggtgcccgaggcggcgcggcgagccgtagccgctggcattgatatt
atcctaatctgcgaacagatcgaaaacgtcaaaaaaaccctagccgctctctctcaatcg
ccagaactggagtctcgtttacggtctgcttggcagcgaatacagcagtataagaagact
ctgccccagctacggcttaatcttgaggccatccaggctcgctttgcgtccgggcactag

DBGET integrated database retrieval system