KEGG   Desulfobacca acetoxidans: Desac_0331Help
Entry
Desac_0331        CDS       T01454                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desac_0331
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desac_0331
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desac_0331
Enzymes [BR:dao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desac_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
405700..407190
Genome map
AA seq 496 aa AA seqDB search
MKLKDFPEDLQPHLLPRPRGRMVYRCLDCGAEFGIDHLFYTCPKCQGLFLLVDLDEEQLK
EHSGAFWRRLFDYRRMLHDPAVQGAFCFHELIAPVIPAEDIVYLGECHTPQVQANSRLQE
EVGMTVYFKNDGQNPSASFKDRGMAAALSYLNYLIRTQNLTGVLAICASTGDTSAAAALY
AAYLGDKVTSAVILPYGKVTPQQLSQPLGAGARVLEIPGVFDDCMRVVEALSEHYHVALL
NSKNSWRIRGQESYAYEIAQWFDYDLAHKVIVVPIGNAGNITAVLEGLLRFHDLQIIAEL
PKVIGVQSQHANPVFTYYLESNPARRVFTPVVVQPSVAQAAMIGRPVSMPRVIRLAAEYT
RRAGEGSFAVVEVTEQEIMDAMLLANRNGHIACTQGGESLAGLQMALKTGLVKKNEVAVV
DATAHHLKFIGFQQMYFDNTFPSEFEIIPKPEYQNHPQLLIPESPPGESPWSEAEQRIFT
QDMVRQVAAVLGLKPK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactgaaagattttccggaagacctccagccccatctacttccccgcccccggggc
aggatggtataccgttgtctggattgcggcgccgaattcggcattgaccacctgttttat
acctgtccaaagtgccagggccttttcttactggtagatttagacgaggaacagctcaaa
gagcattcgggagccttctggcgccggctcttcgactaccggcggatgctccatgacccg
gcggtgcagggcgccttctgcttccatgaactgatagccccagtcattcctgccgaagat
atcgtctatctgggggaatgccataccccccaggtgcaggccaactcccgacttcaggaa
gaagtggggatgaccgtttatttcaagaacgatggccagaatcccagtgcttcttttaaa
gaccggggcatggctgcggccttgagctacctcaattacctgatccgcacccaaaacctt
acaggagtattggccatctgcgcctctaccggagacacttcggcagccgcagccctatac
gccgcttatttaggagacaaagtaacctcagcagtgattctgccctacggcaaggtgaca
ccccagcagctctctcagcctctcggggccggggcccgggtcttagaaattcccggcgtc
ttcgatgattgcatgcgggttgtggaggctttgtccgaacactaccatgtagccttgctc
aactccaaaaacagttggcgcatccggggacaggaatcatacgcctatgaaatagcgcaa
tggttcgactatgatctggcccacaaggttatcgtagtccctatcggcaacgccggcaac
attaccgccgtcctggagggactgctccggtttcacgacctgcagataattgcagaactc
cccaaggtcattggggtgcagtcgcagcacgccaacccggtgtttacctattacctggag
agcaatcccgcgagacgcgtctttacacccgtggtggtgcagcccagcgtcgcccaggcg
gccatgatcggccgaccggtgtccatgccccgagttatccgtctggccgcggaatatacc
cggagggcaggtgaaggaagttttgccgtggtggaggtaaccgagcaggaaatcatggac
gccatgctgctagccaaccgcaacggccatatcgcctgcacccaggggggggaatcccta
gccggactgcagatggcgcttaagaccggactggtgaagaaaaacgaagtggccgtggta
gacgccacggcgcaccatttaaaattcatcggttttcaacagatgtacttcgacaacacc
tttccgtcggagttcgagattatccctaaaccggaatatcaaaaccacccccaactgctt
attcccgaatcaccccccggggaaagcccctggtcggaggcagaacagaggatattcacc
caggacatggtgcgtcaggtagccgcagtattgggcttgaaacccaagtga

DBGET integrated database retrieval system