KEGG   Desulfobacca acetoxidans: Desac_0331Help
Entry
Desac_0331        CDS       T01454                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desac_0331
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desac_0331
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desac_0331
Enzymes [BR:dao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desac_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
405700..407190
Genome map
AA seq 496 aa AA seqDB search
MKLKDFPEDLQPHLLPRPRGRMVYRCLDCGAEFGIDHLFYTCPKCQGLFLLVDLDEEQLK
EHSGAFWRRLFDYRRMLHDPAVQGAFCFHELIAPVIPAEDIVYLGECHTPQVQANSRLQE
EVGMTVYFKNDGQNPSASFKDRGMAAALSYLNYLIRTQNLTGVLAICASTGDTSAAAALY
AAYLGDKVTSAVILPYGKVTPQQLSQPLGAGARVLEIPGVFDDCMRVVEALSEHYHVALL
NSKNSWRIRGQESYAYEIAQWFDYDLAHKVIVVPIGNAGNITAVLEGLLRFHDLQIIAEL
PKVIGVQSQHANPVFTYYLESNPARRVFTPVVVQPSVAQAAMIGRPVSMPRVIRLAAEYT
RRAGEGSFAVVEVTEQEIMDAMLLANRNGHIACTQGGESLAGLQMALKTGLVKKNEVAVV
DATAHHLKFIGFQQMYFDNTFPSEFEIIPKPEYQNHPQLLIPESPPGESPWSEAEQRIFT
QDMVRQVAAVLGLKPK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactgaaagattttccggaagacctccagccccatctacttccccgcccccggggc
aggatggtataccgttgtctggattgcggcgccgaattcggcattgaccacctgttttat
acctgtccaaagtgccagggccttttcttactggtagatttagacgaggaacagctcaaa
gagcattcgggagccttctggcgccggctcttcgactaccggcggatgctccatgacccg
gcggtgcagggcgccttctgcttccatgaactgatagccccagtcattcctgccgaagat
atcgtctatctgggggaatgccataccccccaggtgcaggccaactcccgacttcaggaa
gaagtggggatgaccgtttatttcaagaacgatggccagaatcccagtgcttcttttaaa
gaccggggcatggctgcggccttgagctacctcaattacctgatccgcacccaaaacctt
acaggagtattggccatctgcgcctctaccggagacacttcggcagccgcagccctatac
gccgcttatttaggagacaaagtaacctcagcagtgattctgccctacggcaaggtgaca
ccccagcagctctctcagcctctcggggccggggcccgggtcttagaaattcccggcgtc
ttcgatgattgcatgcgggttgtggaggctttgtccgaacactaccatgtagccttgctc
aactccaaaaacagttggcgcatccggggacaggaatcatacgcctatgaaatagcgcaa
tggttcgactatgatctggcccacaaggttatcgtagtccctatcggcaacgccggcaac
attaccgccgtcctggagggactgctccggtttcacgacctgcagataattgcagaactc
cccaaggtcattggggtgcagtcgcagcacgccaacccggtgtttacctattacctggag
agcaatcccgcgagacgcgtctttacacccgtggtggtgcagcccagcgtcgcccaggcg
gccatgatcggccgaccggtgtccatgccccgagttatccgtctggccgcggaatatacc
cggagggcaggtgaaggaagttttgccgtggtggaggtaaccgagcaggaaatcatggac
gccatgctgctagccaaccgcaacggccatatcgcctgcacccaggggggggaatcccta
gccggactgcagatggcgcttaagaccggactggtgaagaaaaacgaagtggccgtggta
gacgccacggcgcaccatttaaaattcatcggttttcaacagatgtacttcgacaacacc
tttccgtcggagttcgagattatccctaaaccggaatatcaaaaccacccccaactgctt
attcccgaatcaccccccggggaaagcccctggtcggaggcagaacagaggatattcacc
caggacatggtgcgtcaggtagccgcagtattgggcttgaaacccaagtga

DBGET integrated database retrieval system