KEGG   Desulfobacca acetoxidans DSM 11109: Desac_0402Help
Entry
Desac_0402        CDS       T01454                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dao  Desulfobacca acetoxidans DSM 11109
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dao00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
486519..488750
Genome map
AA seq 743 aa AA seqDB search
MTGSNKELLLAELASLYGLAPSYTDNAGQNHPTTSSTQAAILRTMGLQCQSEVALREELN
RRRCLPWTRLTPPVLALCQSQYPAVWDFHTLLQRGRLPHDLKGSWEILDESGQCIHSADF
GPELQVIEVKNFGTDCFGRTAIPLPQTLALGYYDLKVRVETSGFERESRTLLIIAPERVY
TPMALLTRRLWGFSVPLYALRSQTDWGIGDLGDLQRLLGWAAGLQASVIGLNPLHHLGLH
LDQNVSPYYPTSRCYSNPLYLDLSQVPELATCRSAQEYLAQPQVQRQLDELRQGQRINYP
AVATLKFKVLEMLLNTFLEQHGLPALPLTTRGRDFAAFLACEGEPLQRFATFLALSESWR
TAGCSYATWQEWPSVYHNPQGPAVAEFAYTHQRQILLYAYAQWLLAGQLQDTSMAAAAWN
LPLGLYFDLAVGVNPGGFDTWAEPGLFALDADIGAPPDEFSPLGQNWGLAPLLPEHLRES
RYRYFIRMVRHNCPPVGALRLDHVMGLFRLYWIPKGLSPAEGVYVQYPAEEMLKILALES
VRRQTAIIGEDLGTVAPYIRDILGGYRILSTRLFYFERRDDGSFTPAEDYPDWVATSITT
HDLPTLAGFWQGQDIQMRQQLNLFPNNQAATRAWEDRRRAKLAILSLLQHKGWLPPDTAQ
NLAESPELPEEVKWRVISHLAQTPCRLLLLSLEDIFGWLDQQNLPGTKDEYPNWRVKLPK
LLEEIEKAKEPQQAAEIIGCFRD
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgacgggatctaacaaggaacttctgctggctgagttagcctccctctacggcctggca
ccttcttacaccgataacgccggccagaaccatcccaccacctcctcaacccaggccgcc
attctcaggaccatgggtcttcagtgccagagtgaggttgctctgcgagaggaattgaat
cgccgccgttgtctgccttggaccaggctgacaccgccggtgttggccctctgccagtcg
cagtacccggcggtttgggattttcacaccctcttgcagagagggcggcttccccacgac
ctgaaaggctcctgggaaattctggatgaatccggtcagtgtattcattccgccgacttc
ggcccggaactgcaggtaatagaggtcaaaaatttcggaaccgattgttttggccggact
gcaatcccgttgccccagacattggcgctaggctattatgatctcaaagtccgggtggag
acctccggattcgagcgggagagccggacgctgctcatcatcgcaccggagcgggtttat
accccgatggccttgctcaccagacgcttgtggggttttagcgttccgttatatgccctc
cgcagccagaccgactggggcataggtgatctgggcgatctgcagcgcctgctggggtgg
gcggcagggctccaagccagcgttatcggtctcaacccgctgcatcatctaggcctgcac
ttagaccagaacgtcagtccttattatcccaccagccgctgttattccaatcctctctat
cttgacctcagtcaggtaccggaactggccacttgtcgatcggctcaggaatacctggcc
caaccccaggtgcaacggcaattggatgagctgcggcagggccagcggattaactatcct
gccgttgccacattgaaattcaaagtgctggagatgctgttaaatacctttttggagcag
cacggccttccggctttacctctgaccacacgcggcagggattttgccgccttcctggcg
tgcgaaggtgaacccctgcagcgttttgcgacatttctggcgctctcggaatcctggcga
acagcaggctgttcttacgcgacctggcaagagtggccgtcggtctatcacaaccctcaa
ggtccggctgtggctgaattcgcctatacccaccaacgccagatcctgctttacgcctat
gctcaatggctgctggccggacaactgcaggatacctcgatggccgcggcggcttggaat
ctgcccctcgggttatacttcgatctggccgtgggcgtcaatcccggaggttttgacacc
tgggccgagccgggcctctttgccttggacgccgatattggtgctcccccggatgaattc
agtcctttggggcaaaactggggtctggcgccgctgctccccgaacacctgcgggagagc
cgctaccggtattttatccgtatggtgcgccacaactgcccccccgtgggggccctgcgg
ctggaccacgttatgggcctctttcgcctctattggattcccaaaggactcagtccggcg
gagggggtctacgtgcagtatcctgctgaagaaatgctcaagatccttgccctggagagc
gtccggaggcagacggccattatcggggaggatttgggtaccgtggccccttatatccgc
gatattttgggcggctaccggattctgtccacccggttgttttacttcgagcgtcgggat
gacggttcattcaccccggccgaagattatccggactgggtggcgacctccatcaccacc
cacgatcttcccaccctggccggtttctggcaggggcaagatatccagatgcggcaacag
ttaaaccttttccccaacaaccaggcggcaacccgagcctgggaagaccgtcggagagcc
aaactggccatcttgagcctgctgcagcacaaaggctggctaccccccgataccgcgcag
aatctggcggaatcgccggaactgccagaagaggtaaaatggagagtaatctcgcacctg
gcccaaacgccctgccgcctgctgcttctgagcctggaggatattttcggctggctggac
caacagaatctgccgggcactaaagatgagtacccgaattggcgggtgaagttacctaaa
ctccttgaggaaatcgaaaaggcgaaggagccgcaacaggcagccgagattatcggctgc
tttcgggattag

DBGET integrated database retrieval system