KEGG   Desulfobacca acetoxidans: Desac_0411Help
Entry
Desac_0411        CDS       T01454                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
dao  Desulfobacca acetoxidans
Brite
Enzymes [BR:dao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Desac_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
499434..500429
Genome map
AA seq 331 aa AA seqDB search
MSKTLVTGATGFVGRAVTTELLAQDREVRVLARHPQHRALHGLEVEIVRGDLTDAASLRS
ALQDCSRLFHVAADYRLWVPDPKAMYAVNIEGTRSLLQTALELGLERVVYTSTVGTLGNP
GDGTPGTEDTPVTLTEMVGHYKKSKFLAEQVALDFSRQGLPLVIVNPSTPVGPWDVRPTP
TGQVIVDFLKGRMPAFLDSGLNLVHVRDVARGHILAEAKGRIGEKYILGNQNMTLAEILG
LLAKISGLSAPRWRLPYYPVLGLAYVNEFWSTWITRRPPRVPLTAVKMAKKIMYFDPQKA
VRELGLPQTPVVAALREAVDWFRAQGYVKEN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaacactggttaccggggccaccggttttgtcggtcgcgccgtaacgacggaa
ttattggcccaggaccgagaggtcagagttctggcccgccacccccagcatcgcgccttg
cacggtctggaagtggaaatcgttcggggcgatttaaccgatgcagcgtcgctgcgatcg
gccctgcaggactgctcccgactcttccacgtagccgcagactaccggctctgggttccc
gaccctaaggctatgtacgccgttaacatcgaagggaccagatcgctgttgcagactgcg
ctagaactcggcttggaacgggtggtctataccagcaccgtcggaaccctgggaaacccc
ggagatggcactcccggtaccgaagatactccggtaaccctgacggagatggtaggacac
tataagaaatcaaaatttctggccgagcaggtggccttggatttttccaggcagggatta
cctctggtgattgtcaatcccagtacaccggtgggcccttgggatgtacggcctactcct
accgggcaggtaatcgtcgactttttgaagggcaggatgccggcctttttggactccggc
ctgaatcttgttcacgtccgggatgtggcccggggacatatcctggccgaagccaagggc
agaattggtgaaaaatatatcttaggtaatcagaacatgaccctggcggagattttgggg
ctgttggctaagatcagcggcctctctgccccccgatggcgccttccctactacccggtt
ttaggtctggcctatgtcaatgaattctggtcgacttggattacccggcggcctccccgg
gtaccccttactgctgtcaaaatggcgaaaaaaattatgtacttcgatcctcaaaaagcc
gttcgggaactggggctgccgcaaaccccagtggtcgcggccttgagggaagcggtggat
tggtttcgcgctcagggttatgtgaaggagaattaa

DBGET integrated database retrieval system