KEGG   Desulfobacca acetoxidans: Desac_0447Help
Entry
Desac_0447        CDS       T01454                                 

Definition
methyltransferase type 11
Orthology
K00570  
phosphatidylethanolamine/phosphatidyl-N-methylethanolamine N-methyltransferase [EC:2.1.1.17 2.1.1.71]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, PE => PC
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Desac_0447
Enzymes [BR:dao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.17  phosphatidylethanolamine N-methyltransferase
     Desac_0447
    2.1.1.71  phosphatidyl-N-methylethanolamine N-methyltransferase
     Desac_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
543899..544531
Genome map
AA seq 210 aa AA seqDB search
MKTKINGQYMERLYSFYSPFYDFVFGKMLEPGRREAFKYLSSRPHQKVLEIGIGTGASLT
LYPPHTQVIGIDISEGMIKKAKKRLAALKNGHDVELKVMDACNLEFPNESFDAVIASYVI
TTVPDPHRLCKEILRVIRPGGQIIAVQHSRGENGHLLEKAKDALAPLFVRIGFTTDLDVV
RVMRESGMSIEHICGCNIFKLHRLITGTKR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagatcaatggccaatatatggaacgtctgtattccttttactctcctttt
tatgattttgtgttcggtaagatgctcgagcccggcaggagggaggcttttaaatacctc
tcctcccgcccccatcaaaaagttttggagatcggcatcggcaccggcgccagtttaacc
ctctatcccccccacacccaggtcatcggcatcgatatctccgaaggcatgatcaaaaag
gcgaaaaaacggctggcagccctaaaaaatggccatgatgtcgaactcaaggtgatggac
gcctgcaatctagaatttcccaatgagagtttcgacgcagttatcgcctcctatgttatt
acgacggttcctgacccccataggctctgtaaagaaatcctgcgagttatccgcccgggt
ggacagattattgccgtccaacattcccgcggggaaaatggccacttattggaaaaggcc
aaagacgccttggcgcccctgtttgtccgcatcggttttactacagatttagacgtcgtt
cgggttatgcgggagtccggtatgtccattgaacatatctgcggctgtaatatctttaaa
ttgcaccgcctcattaccggaaccaaaagatag

DBGET integrated database retrieval system