KEGG   Desulfobacca acetoxidans: Desac_0447Help
Entry
Desac_0447        CDS       T01454                                 

Definition
(GenBank) Methyltransferase type 11
  KO
K00570  phosphatidylethanolamine/phosphatidyl-N-methylethanolamine N-methyltransferase [EC:2.1.1.17 2.1.1.71]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao00564  Glycerophospholipid metabolism
dao01100  Metabolic pathways
dao01110  Biosynthesis of secondary metabolites
Module
dao_M00091  Phosphatidylcholine (PC) biosynthesis, PE => PC
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Desac_0447
Enzymes [BR:dao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.17  phosphatidylethanolamine N-methyltransferase
     Desac_0447
    2.1.1.71  phosphatidyl-N-methylethanolamine N-methyltransferase
     Desac_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Ubie_methyltran Methyltransf_12 Methyltransf_23 MetW UPF0020 PCMT NodS CMAS Methyltransf_4 Methyltransf_16 Pox_MCEL Methyltransf_2 Methyltransf_29 MTS DREV PrmA
Motif
Other DBs
NCBI-ProteinID: AEB08334
JGI: Desac_0447
UniProt: F2NEZ4
Position
543899..544531
Genome map
AA seq 210 aa AA seqDB search
MKTKINGQYMERLYSFYSPFYDFVFGKMLEPGRREAFKYLSSRPHQKVLEIGIGTGASLT
LYPPHTQVIGIDISEGMIKKAKKRLAALKNGHDVELKVMDACNLEFPNESFDAVIASYVI
TTVPDPHRLCKEILRVIRPGGQIIAVQHSRGENGHLLEKAKDALAPLFVRIGFTTDLDVV
RVMRESGMSIEHICGCNIFKLHRLITGTKR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagatcaatggccaatatatggaacgtctgtattccttttactctcctttt
tatgattttgtgttcggtaagatgctcgagcccggcaggagggaggcttttaaatacctc
tcctcccgcccccatcaaaaagttttggagatcggcatcggcaccggcgccagtttaacc
ctctatcccccccacacccaggtcatcggcatcgatatctccgaaggcatgatcaaaaag
gcgaaaaaacggctggcagccctaaaaaatggccatgatgtcgaactcaaggtgatggac
gcctgcaatctagaatttcccaatgagagtttcgacgcagttatcgcctcctatgttatt
acgacggttcctgacccccataggctctgtaaagaaatcctgcgagttatccgcccgggt
ggacagattattgccgtccaacattcccgcggggaaaatggccacttattggaaaaggcc
aaagacgccttggcgcccctgtttgtccgcatcggttttactacagatttagacgtcgtt
cgggttatgcgggagtccggtatgtccattgaacatatctgcggctgtaatatctttaaa
ttgcaccgcctcattaccggaaccaaaagatag

DBGET integrated database retrieval system