KEGG   Desulfobacca acetoxidans DSM 11109: Desac_0503Help
Entry
Desac_0503        CDS       T01454                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dao  Desulfobacca acetoxidans DSM 11109
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dao00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
607493..608182
Genome map
AA seq 229 aa AA seqDB search
MKGRGKREKGIRQALAEQKRELVQVCRALSQKKLLAATDGNLSVRWGENLLITPSGVNKG
FVREEEMIMVDLSGRVLAGSGRPTTELLLHLEVYQVRPEVQAVVHAHPPIATAFTIAGVP
LLEGILPEVVLTLGAIPTAPYATTGTPEMATAVRDLLPFYDAILLDHHGALTLGRDLWDA
YNKMEKVEHAALTVLLARQLGAARPLPPEEVAKLTDLGISKGYRPSGAG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggaagagggaaaagggaaaagggaattagacaggcgctggcagagcagaagcgg
gagttggtgcaggtgtgccgggcgctttcccagaaaaagttgctggcggccacggatggc
aacctgagcgtgcgttggggtgagaacctcctcattactccgagcggagtcaacaaggga
tttgtccgggaagaagagatgatcatggtagacctgagcggccgggtgttggccggttcc
gggcggcctaccaccgagttgctgctgcatctggaggtctatcaggtgcggccggaggtt
caggcagtggtccacgcccatccgcccatcgccaccgcctttaccatagccggcgttcct
ctcctggaaggcatcctgccggaggtggtactgaccttgggggctatcccgacggcgccc
tacgccaccaccgggactcccgagatggcgacggcggtccgggatctgcttccattttat
gacgccatattactggaccaccacggtgccctgacgctgggccgggacttatgggacgcc
tataacaaaatggaaaaggtggaacatgccgctctgaccgtgttgttggcccgacagttg
ggcgccgcccggccgctgcctcccgaggaagtggcaaaattgaccgacctgggaatcagc
aagggctaccggccgtcgggggcgggataa

DBGET integrated database retrieval system