KEGG   Desulfobacca acetoxidans DSM 11109: Desac_0723Help
Entry
Desac_0723        CDS       T01454                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dao  Desulfobacca acetoxidans DSM 11109
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dao00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
849041..849925
Genome map
AA seq 294 aa AA seqDB search
MPSGTFLDLEPISVREAEIVVVPIPYEATTSYGGGTRYGPEAILSASRQVELWDEEGDWD
PSQVIRLATAAEITPDAGGPGPMLEKIKKRVKPWIAEGKLLISLGGEHTIAQALVESYLT
RHPDLTVVALDAHADLRDTYEHSPFSHACVMRRVWELGRPLTLIGVRSYSAKEYDFIRVA
PRLTLLKARSLVDPDYLQLTLEHLRRLKGPVYISLDVDALDPAVMPATGTPEPGGLNYYQ
TLTILKAIVERGPVVGLDLTELAPIPGHRVSEFTAARLIYKFLGYLYQGRRAAK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagggacgttcttagatttagagccgataagcgtacgtgaggctgagatagtt
gtcgtgccgatcccttatgaagccactaccagctatggcggtggaacccgctatggtccg
gaggctatcttatcggccagccggcaggtagaattgtgggacgaagaaggggattgggac
ccgagccaggttatccgtctggctacggctgccgagatcaccccggatgccggcggcccc
ggccctatgctcgagaaaatcaagaagcgggtgaagccttggatcgccgagggtaagtta
ttaatcagcctgggcggcgaacacaccattgctcaggccttagtggagtcttatctgacc
cggcaccccgacctgaccgtggtggccttggatgcccatgcggatctgcgggatacctat
gaacacagtcccttttcccatgcttgcgttatgcggcgggtatgggaactgggtcgaccc
ctgaccctgatcggggtgcgcagttattcggctaaagaatacgactttatccgggtagcc
ccccgccttaccctgctcaaggccaggagcctggtcgaccctgactatctgcagctaacg
ctggagcatttgagacgccttaaggggccggtctatatctccctggacgtggacgccctg
gatcctgcggtcatgccggcgaccggcacgccagagccgggtgggttgaattattaccag
accctgactatcttaaaggctattgtcgaacgaggtccggtggtgggactggatctcacc
gaattggctcccatcccgggacaccgggtgagtgaattcaccgctgcccggttgatctat
aaatttctgggatacctctatcaggggcgtcgggcggcaaaataa

DBGET integrated database retrieval system