KEGG   Desulfobacca acetoxidans: Desac_0723Help
Entry
Desac_0723        CDS       T01454                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dao  Desulfobacca acetoxidans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desac_0723
Enzymes [BR:dao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Desac_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
849041..849925
Genome map
AA seq 294 aa AA seqDB search
MPSGTFLDLEPISVREAEIVVVPIPYEATTSYGGGTRYGPEAILSASRQVELWDEEGDWD
PSQVIRLATAAEITPDAGGPGPMLEKIKKRVKPWIAEGKLLISLGGEHTIAQALVESYLT
RHPDLTVVALDAHADLRDTYEHSPFSHACVMRRVWELGRPLTLIGVRSYSAKEYDFIRVA
PRLTLLKARSLVDPDYLQLTLEHLRRLKGPVYISLDVDALDPAVMPATGTPEPGGLNYYQ
TLTILKAIVERGPVVGLDLTELAPIPGHRVSEFTAARLIYKFLGYLYQGRRAAK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagggacgttcttagatttagagccgataagcgtacgtgaggctgagatagtt
gtcgtgccgatcccttatgaagccactaccagctatggcggtggaacccgctatggtccg
gaggctatcttatcggccagccggcaggtagaattgtgggacgaagaaggggattgggac
ccgagccaggttatccgtctggctacggctgccgagatcaccccggatgccggcggcccc
ggccctatgctcgagaaaatcaagaagcgggtgaagccttggatcgccgagggtaagtta
ttaatcagcctgggcggcgaacacaccattgctcaggccttagtggagtcttatctgacc
cggcaccccgacctgaccgtggtggccttggatgcccatgcggatctgcgggatacctat
gaacacagtcccttttcccatgcttgcgttatgcggcgggtatgggaactgggtcgaccc
ctgaccctgatcggggtgcgcagttattcggctaaagaatacgactttatccgggtagcc
ccccgccttaccctgctcaaggccaggagcctggtcgaccctgactatctgcagctaacg
ctggagcatttgagacgccttaaggggccggtctatatctccctggacgtggacgccctg
gatcctgcggtcatgccggcgaccggcacgccagagccgggtgggttgaattattaccag
accctgactatcttaaaggctattgtcgaacgaggtccggtggtgggactggatctcacc
gaattggctcccatcccgggacaccgggtgagtgaattcaccgctgcccggttgatctat
aaatttctgggatacctctatcaggggcgtcgggcggcaaaataa

DBGET integrated database retrieval system