KEGG   Desulfobacca acetoxidans: Desac_0739Help
Entry
Desac_0739        CDS       T01454                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desac_0739
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desac_0739
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desac_0739
Enzymes [BR:dao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desac_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
867620..868981
Genome map
AA seq 453 aa AA seqDB search
MADSYRILLGENELPQQWYNVQPDLPRPLPPYLHPATGKPVTPDDMLPIFPMELILQEVS
QERWIEIPDEVLDIYRLWRPSPLHRARRLEKLLKTPARIYFKNESVSPAGSHKPNTAVPQ
AYYNKMAGVTRLATETGAGQWGSALSFACNAFGLGCTVYMVKVSYQQKPYRRSMMQIWGS
EVYPSPTDRTDSGRAILAQDPESPGSLGIAISEAVEDAVKHEDTKYALGSVLNHVLVHQS
IVGLETKKQLQLAGEKADVLVGCVGGGSNFAGFCFPFVPDKLKGDNIRMVAVEPTSCPTF
TKGAYMYDFGDTAGLTPLMLMYTLGHSFVPPGIHAGGLRYHGDAPLLSLLVHEKVIEARA
YPQNPVFEAAIAFARTEGIVPAPETAHAIRAGVDEALKCKETGEEKCIVIAFSGHGFLDL
AAYDNFIGGNLIDFEYPDSKIQEAIAAIPKFPG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggccgactcttacagaattctcttaggtgaaaatgagcttccccaacaatggtataac
gtccaacccgatttacccagaccgctgccgccgtatctccatccggcgacggggaaaccg
gttactccggacgatatgttgcccattttccctatggagcttatcttacaggaggtgagc
caggaacgttggatcgaaattcctgatgaagtattagacatttatcgactctggcggcca
tcgcccctgcatcgggcccggcgtctggaaaaacttctgaaaaccccggcacgcatctat
ttcaagaacgaatcggtgagcccggccggcagccacaaacccaatactgccgtaccccag
gcctattacaacaaaatggccggggtaacccgcttggctaccgagaccggcgccggacaa
tggggttcggccctgtccttcgcctgcaatgccttcggtctgggctgcaccgtttacatg
gttaaggtcagctaccaacagaaaccataccgtcgttccatgatgcagatctggggttcc
gaggtgtatccttcccccactgaccgcactgactccggccgcgctattttggctcaagat
cccgaatctcctgggagcttaggtattgccatctccgaagcggtagaagacgcagtcaag
catgaagatactaaatacgctttgggaagcgtgttgaaccatgtgctggtacaccagtcc
attgttggcctggagaccaaaaaacaactgcagttggccggtgaaaaagccgatgtgttg
gtaggctgcgttggcggcggcagcaattttgccggtttttgctttccctttgtgccggac
aagttgaagggggataatatccgcatggtggcggtggagccgacctcatgcccgacgttt
accaagggtgcctacatgtatgatttcggcgacaccgccggtctgacgcccctgatgttg
atgtataccctgggacacagctttgtgccccccggaattcatgccggcggcctgcgctac
cacggcgacgccccgctgctcagcctgctggttcatgagaaagtcatcgaagccagagct
tacccgcagaatccggtgttcgaggccgccatcgcctttgcccggacagaaggcatcgtt
ccggcgccggaaaccgcccacgccatcagagcaggcgtcgacgaagccctgaaatgcaaa
gaaacgggagaggaaaagtgtatcgtgatcgccttcagcggccacggctttctggatctg
gcggcctacgacaactttatcgggggaaatttaatagacttcgaatatccggactcgaag
attcaggaggccatcgccgccatcccgaaattccccggttaa

DBGET integrated database retrieval system