KEGG   Desulfobacca acetoxidans: Desac_0823Help
Entry
Desac_0823        CDS       T01454                                 

Definition
(GenBank) CoB--CoM heterodisulfide reductase
  KO
K03389  heterodisulfide reductase subunit B2 [EC:1.8.7.3 1.8.98.4 1.8.98.5 1.8.98.6]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao00680  Methane metabolism
dao01100  Metabolic pathways
dao01120  Microbial metabolism in diverse environments
dao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Desac_0823
Enzymes [BR:dao01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.3  ferredoxin:CoB-CoM heterodisulfide reductase
     Desac_0823
   1.8.98  With other, known, physiological acceptors
    1.8.98.4  coenzyme F420:CoB-CoM heterodisulfide,ferredoxin reductase
     Desac_0823
    1.8.98.5  H2:CoB-CoM heterodisulfide,ferredoxin reductase
     Desac_0823
    1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase
     Desac_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG Tube
Motif
Other DBs
NCBI-ProteinID: AEB08702
JGI: Desac_0823
UniProt: F2NGT1
Position
complement(963070..963936)
Genome map
AA seq 288 aa AA seqDB search
MMAPMKVTYYPGCSLEGTARDYAASLNAVCRALGVELIELQDWNCCGATAAHAIDHQAAL
ALAGRNLALAEKGGRDLVVPCPLCFNRLKTAAWALTGDKPKSSGYPLQWARKIYDLADFL
ARERFLKLMASMVRRPLNGLRAVCYYGCMASRPPKVTGASNCENPTSLDRILSQVGVEVK
PWSYKTDCCGASHLIARRDIVFKLAGRLYDKAMEAGANCMVVSCQMCQANLDLYQDKILQ
ELGLSYYLPIFYFTELIGLALGLSEARQWVGSHFVTPARLLAEVGLAP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaccgatgaaagtcacttactatcccggatgttccctggaaggcactgccaga
gattacgccgcctctcttaacgccgtatgccgggcgctgggagtggagctcatcgaactg
caggactggaactgttgcggcgccaccgccgctcatgccattgatcaccaggcggcctta
gccttggccggtcgcaatctggcgctggccgagaaagggggccgcgacctggtagttccc
tgtcccctctgttttaaccggctcaagaccgcggcgtgggcacttacaggagataagcct
aaatcttctggctatcccttgcagtgggccagaaagatttacgatctagcggattttttg
gcccgggaacgattcctcaaactcatggccagcatggtcaggcgtccgctaaacggactt
agagccgtttgttactatggctgtatggccagccgtccgcctaaagttaccggggcctcc
aactgcgaaaatcccaccagtctggaccgcattctgagtcaggtgggagtggaggtcaaa
ccctggtcctacaaaacggattgctgtggtgccagccacctgatcgctcgccgcgacatc
gtttttaagctggcaggtcgtctatatgataaggcgatggaggccggggccaactgtatg
gtggtttcctgccagatgtgccaggccaacctggatctgtatcaggacaagatcttacag
gaactcggcctttcgtattatctccccatattttatttcaccgaacttatcggactggcc
cttggtcttagtgaagcccggcagtgggtaggcagccattttgtgacgcccgctcgcctg
ttagccgaggtcgggctggcaccctga

DBGET integrated database retrieval system