KEGG   Desulfobacca acetoxidans: Desac_0932Help
Entry
Desac_0932        CDS       T01454                                 

Definition
(GenBank) Asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao00250  Alanine, aspartate and glutamate metabolism
dao01100  Metabolic pathways
dao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desac_0932
Enzymes [BR:dao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Desac_0932
Peptidases [BR:dao01002]
 Cysteine Peptidases
  Family C44
   Desac_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AEB08802
JGI: Desac_0932
UniProt: F2NH31
Position
complement(1083823..1085751)
Genome map
AA seq 642 aa AA seqDB search
MNGILGYLRLDGAPVAKTKLAVMQQAMAYWGVDGSTEWSDGPVGLGCQFCFCTPEETEKS
FPYHDPERGWVLTAGAFLDNREDLIAELGLSAPEGRVLSDTRLIHRAYERWGEECIHHLL
GDWHFALWDLKNRRLFLARDHHGNTGICYIQGPGFFAFASSRKALLALPEVPRVPNLLRL
AQTLTSWPGDGILTAHAGIYRLPPAHYLIIEAGEVKIKRYWFAENAPRVYFPREEDYLEA
FLEHYDRAVRARLRSTTAISATLSGGLDSGSVCALAARALAQQGQRLSAFTSVPLEDTSP
YTLKHRFGDESAFAQATADQAGNIDLTRIRAAEVSPLAGIDRMLQVHDEPGHAAGNYFWI
IALLDRVREHGFRVLLTGQGGNATVSWTGGAVNLWPYLGSGQLSRFRQKFLDLQQRQGLS
LFAGVKRFLAGPLVLPILSRLEYGLCPNGPVFLPYSAIHPRWAQSLHLDRLMRAQGHDPY
FNTDYNPLATRYRIIQPGRWPGGGLWGESSGAFGLETRDPTLDKRLLEFCLGIPDIYHSA
EGSNRAVLRRAFRDLLPDLVRLNRRRGLQAADICRRLRDQATDIEEALQDLERHNLAPAI
LDLPKMRRVLRSIQQGTTRKNSSEAGTILLRGLGVGIFLQRF
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcatattaggatatctgagattagacggcgccccggtggctaagacgaaactg
gcggtcatgcagcaggccatggcctattggggggtggatggctccaccgagtggagcgat
ggcccggttggattgggctgccagttctgtttttgcaccccggaagagaccgaaaaatct
ttcccgtatcatgacccggaacgcggttgggtgttgaccgccggggcctttctggataat
cgggaagacctgattgcggaactgggcctgtcagccccggaaggccgggttttgtccgac
acccggctcatccatcgggcttacgagcgctggggggaggagtgcatccatcacctgttg
ggcgattggcactttgccctctgggacctgaagaatcgccgtttattcctggcccgggat
catcatggcaatactggaatctgttatatccaggggccgggatttttcgccttcgcttcc
agccgcaaggccctgctggcgctcccggaagtgcctcgggtgccgaacctgctgcgactg
gcccagaccctcaccagttggccgggcgatggcattctcaccgcccatgccgggatctac
cgcctgcctccggcccattatctgatcatcgaagccggcgaagtaaagatcaagcgctac
tggtttgccgaaaacgcccctcgggtttacttcccccgagaggaagactatctggaggcc
ttcctggagcactatgatcgggcggtgcgagcccgtctgcggtcgactacggcgataagc
gccaccttgagcggcggcttggattcgggttcggtctgcgccctggcggcccgggcgctg
gcccaacaggggcaaagattgtccgccttcacctctgtccccctggaggacaccagtcct
tataccctcaaacaccgcttcggcgatgagtcggccttcgcccaggccactgccgaccag
gccggtaatattgaccttaccaggatcagggcggcagaggtttctccgttggcaggcatc
gaccgtatgctgcaggttcacgatgaaccgggccatgccgccggcaattatttctggatt
atagcgctcctcgatagggtcagggagcatggcttccgggtgctcttgaccggccaggga
ggcaacgccaccgtctcctggaccgggggagcggtgaacctctggccgtatctggggtcc
ggacagctcagccggttcaggcagaaattcctggatctgcaacagcgccagggtctctcc
cttttcgccggggtcaaacgcttcctggcgggccctttggtccttccaatcctcagtcgc
ctggaatacggcctctgccccaatggcccggtgttcctgccctactcggccatccatccc
cgctgggcgcagtccctgcatctggatcgcctcatgcgggcccagggtcatgatccctat
tttaatacagactacaaccccttagccaccaggtaccggatcatccagcccggccggtgg
ccgggggggggcttatggggcgaaagcagcggcgcttttggcctggagacgcgcgatccg
actttggacaagcgtctgctcgaattctgcctgggcatacctgatatttaccattccgcc
gagggcagtaatcgggcagtgctgcggcgggccttccgcgatctgctgccggatctggta
cgcctcaaccgccgccgggggctgcaggcggctgatatctgccgccgcctgcgggatcag
gccacggacatcgaagaggcgctgcaagacctggaaaggcataacctggccccggcgatc
ctcgacctgccgaagatgcggcgggtgctccgctcgattcagcaggggaccacccgcaag
aattcaagtgaggccggaaccattctcctacgggggttgggggtcgggatcttcctccag
cggttctga

DBGET integrated database retrieval system