KEGG   Desulfobacca acetoxidans: Desac_1053Help
Entry
Desac_1053        CDS       T01454                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao00010  Glycolysis / Gluconeogenesis
dao00052  Galactose metabolism
dao00500  Starch and sucrose metabolism
dao00520  Amino sugar and nucleotide sugar metabolism
dao00521  Streptomycin biosynthesis
dao01100  Metabolic pathways
dao01110  Biosynthesis of secondary metabolites
dao01120  Microbial metabolism in diverse environments
dao01130  Biosynthesis of antibiotics
dao01200  Carbon metabolism
Module
dao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_1053
   00052 Galactose metabolism
    Desac_1053
   00500 Starch and sucrose metabolism
    Desac_1053
   00520 Amino sugar and nucleotide sugar metabolism
    Desac_1053
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desac_1053
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Desac_1053
Enzymes [BR:dao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Desac_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEB08917
JGI: Desac_1053
UniProt: F2NH75
Position
complement(1212520..1213515)
Genome map
AA seq 331 aa AA seqDB search
MVQQRITAEPESLVMAGDLGGTNFRLALVTRTGEIIRRLTLPTPKGKGADHLLDRMAAAI
LGLMEEEGIIPGRLQAVGMGIAGLIQPDKGRVVKSPNIPELDWIWLGPELRRRLPWPVTI
DNDANLFALGEHYQGAGRGEDNLLGLTLGTGVGGGLILNGRLWQGAGGPSAEVGHITIDP
EGERCSCGNQGCLETLASATWTVRWTAERLAAGQKSLLQKNWRENPEGLSALTIYQAATA
GDALAQKAFQRVGRALGIAIADVVHLLGIPLIIIGGNFAQSWDRFIGPLREELERRLTFF
PAAKLVIRPAALGDNGGLLGAARLAWMQVSC
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcaaagaatcacggcagaaccagaatccctggttatggccggagacctgggg
ggaacgaacttccgtctggccttggtgaccaggactggggagattatccgacgtctgact
ctgccaacccccaagggtaagggcgccgatcaccttctagaccggatggctgccgccata
ttaggcctgatggaagaggaaggcattattccagggcgccttcaagccgttggaatgggg
atagccggtctcatccaaccagataaaggacgggtagtgaaatcccctaatattcccgaa
ttggactggatctggcttggaccggaactcaggcggcggttgccttggccggtaaccata
gacaacgacgctaatctctttgccctgggcgaacattaccagggagctggccgcggcgag
gacaacctgttgggcctcactctgggaaccggcgtcggcggcggcttaatcctgaacggc
aggctctggcagggggccggcggcccttcagcagaggtcggccatattaccatcgacccg
gaaggcgagcgctgttcctgtggcaaccagggttgcctggagaccttggcttcagccacc
tggacggtgagatggacagccgaacgcttggctgccggacaaaaatccctgctccaaaaa
aactggcgggaaaatcccgagggactctcagccttgacgatttatcaggctgcgactgcc
ggagatgccctggcgcaaaaagcctttcagcgggtcggccgagccctgggaattgccata
gccgatgtggtgcacctcctgggcatccctttgatcattattggcggcaacttcgcccag
tcttgggatcgattcatcggtccactgagagaagagttggaacgaagactcacgttcttc
ccagcggctaagctagtcattcgacccgcggccttgggcgataatggcggcctcttgggc
gccgccaggctggcgtggatgcaggtttcctgctaa

DBGET integrated database retrieval system