KEGG   Desulfobacca acetoxidans: Desac_1117Help
Entry
Desac_1117        CDS       T01454                                 

Definition
(GenBank) Cellulase
Organism
dao  Desulfobacca acetoxidans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1294245..1295306)
Genome map
AA seq 353 aa AA seqDB search
MSNALDLLRRLSDSFGPPGGEAPVARIVEEYLSPFCRMDRDGLGSLVAEKTGQDQSPRLM
LAAHLDEVGFMVQGVTAQGYLRLQALGGWEPSLLPGRRLQIQTATGSLEGIVAAVPFHFR
PEAKKDIKIEDLLVDIGAASISEVQALGVCLGDLAVPRSGFATLNNDYLVNKAWDDRVGV
AAMILALQRLREQPHPNTVLAVGTVQEEVGCRGATTAVEAAKPDIAIVLEGPPADDLPGL
SQDPPQGALGKGVQIRLFDPTVIVPQKLWRWTVELAQQRHIPYQLAVRRGGATDARAIHL
AHGGVPTLVLGAPVRYAHSPVGIIHRQDFAAMVELTVAIIETLDAERLAALSA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgccttggatctcctgcgccgactgtctgacagtttcggtcctcctggcgga
gaagcgccggtagcccggatagtggaagaatatctgtcgcctttttgccggatggaccgc
gacggcttaggatcgctcgtggcagagaagaccggccaggatcaatcgccgcgtctgatg
ttagcggcacatctcgatgaggtcggtttcatggtgcaaggggtgacagcccagggatac
ctgcgtctccaagctttagggggttgggaaccgagtctgttgccagggcggcgccttcag
atccagaccgccaccggcagcctcgaaggcattgtagccgcggttccgtttcatttccgc
ccggaagctaagaaagacatcaaaatagaagacctcctggtagacatcggggctgcttcg
atatcggaagttcaggctctcggtgtttgcttaggtgatctagccgtcccccggagtggt
tttgccaccctaaataatgattacctggtcaataaagcctgggacgaccgggtgggagta
gcggccatgatcttggccctgcagcgattacgggaacagccacatcctaatactgttttg
gcagtgggcacagtgcaggaagaagtgggctgccggggggcaaccacggcagtggaggcg
gccaaaccggacatagccattgtcctggaagggccgccagccgacgatctgcccggcttg
agccaggatccgccccaaggggctttaggcaaaggggtgcagatccgcctctttgatccg
accgtcattgtcccccaaaaactctggcgttggacggtggaactggcccaacaacgtcac
attccttatcagttggccgtcaggcgcggcggcgcgacggatgctcgagcgattcacctg
gcccacggcggcgtccccactctcgttctgggcgcgccggtgcgttatgcccactctccg
gtaggaataatccaccgccaggatttcgccgccatggtagaactgaccgtggccatcatc
gaaacactcgacgcagagcgcctggcagctttatccgcatag

DBGET integrated database retrieval system