KEGG   Desulfobacca acetoxidans: Desac_1353Help
Entry
Desac_1353        CDS       T01454                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desac_1353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_1353
   00020 Citrate cycle (TCA cycle)
    Desac_1353
   00620 Pyruvate metabolism
    Desac_1353
   00640 Propanoate metabolism
    Desac_1353
   00650 Butanoate metabolism
    Desac_1353
  Energy metabolism
   00680 Methane metabolism
    Desac_1353
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desac_1353
Enzymes [BR:dao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desac_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1563827..1564816)
Genome map
AA seq 329 aa AA seqDB search
MDKFGVANSQKFDVYASRLMPREEFFTSGHRSCQGCGEALAVRWVCKAIGKDAVIAHATG
CMEIVSSGFPQTAWKHPWIHVAFENTSAVAAGIETAYRILHRKGKLAHLPKVVAMGGDGG
TSDIGLQSLSGAMERGHNFTYVCWDNEAYMNTGIQRSSSTPYGAMTTTSPPGRLSIGQHT
WKKNMVAIAVAHGIPYVATANPSYPFDLYFKVKKALETPGPAYIHVLSVCPTGWRSATDL
TVRLGRLAVESAVFPLYEVVNGRYRLTIEIPKIRPVKDYLKPQGRFRHLREPEVNFIQQQ
VLERYDLLLKKCEAPYPEFPSLAPLEEGE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggataaattcggtgtggccaacagccaaaaatttgatgtgtacgcctcccgcctgatg
cctcgggaagaattctttacctccggccatcgctcctgtcagggctgtggcgaagccctg
gccgtccgctgggtttgcaaggccatcggcaaagatgccgtcattgcccacgccaccggt
tgcatggaaatcgtctcttccggcttcccccaaaccgcttggaaacacccctggattcac
gtggccttcgaaaacacctcggcggtagccgccggtatcgaaaccgcctatcgcatcctc
caccgcaaaggcaaattggcccatctccccaaggtcgtggccatgggcggcgacggcggc
acctccgacatcggcctccaatctttgtccggagccatggagcggggacataacttcacc
tacgtctgttgggacaacgaagcctacatgaataccggtattcagcggtccagctccacc
ccctacggcgccatgactaccacctcaccgcccggtcgcctgagtatcggccaacatacc
tggaaaaagaacatggtagccatcgccgtggcccacggcattccctatgtggccaccgcc
aatccgagctacccgtttgatttatattttaaggtcaagaaggctctcgagacccctgga
ccggcctatattcatgttctctcggtctgtcccaccggttggcgctccgctaccgatctc
accgtccgtctcggacggttggcagtggaatccgcggtcttccccctgtatgaggtagta
aacggccgctaccgcttaaccatcgagattcccaagatacggccggtaaaggattatctc
aaacctcaaggccgctttcggcatcttcgggaaccggaagtcaatttcattcagcagcag
gttctggagcggtatgatctgttattgaagaaatgtgaggccccctatccggagtttcct
tcactcgcgcccctggaagaaggtgaataa

DBGET integrated database retrieval system