KEGG   Desulfobacca acetoxidans: Desac_1356Help
Entry
Desac_1356        CDS       T01454                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desac_1356
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_1356
   00020 Citrate cycle (TCA cycle)
    Desac_1356
   00620 Pyruvate metabolism
    Desac_1356
   00640 Propanoate metabolism
    Desac_1356
   00650 Butanoate metabolism
    Desac_1356
  Energy metabolism
   00680 Methane metabolism
    Desac_1356
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desac_1356
Enzymes [BR:dao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desac_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1566281..1566838)
Genome map
AA seq 185 aa AA seqDB search
MLEIRFHGRGGQGAVTSVELLAVAAIEEGKFAQGFPSFGPERRGAPVLAFLRIDDHHIRL
RCKIANPDVVLILDPSLIRIQNPAADLKPEGVIVLNTNKSIADTRREFGFKHRLAVVDAN
QIARQVLGVPITNTTMLGALIRATGAVKVDSMTQPLKERFGPMAVKNITALQTAFEKTVV
GEAKS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaatccgttttcatgggcggggcgggcaaggggctgtaacctcggttgagctt
ctggctgtagccgccatcgaggaaggcaagtttgctcaaggctttccaagctttggccct
gaacgtcggggagcgccggttttggccttcttgcgcattgacgaccaccatatccgcctg
cgctgcaaaattgccaatcctgatgtcgtgctcatccttgatcccagtctgattcgcatc
caaaaccccgcggccgacctcaagccggagggggtcattgttttgaataccaataaatcc
attgccgacacccgccgggaatttggctttaagcatcgtctggccgtggttgatgccaat
caaatcgcccgccaggttttgggggtgcccatcaccaataccactatgttgggcgccctg
atccgcgccaccggtgccgtcaaggtcgattccatgacccagcccctgaaagagcggttt
ggacctatggcggtaaagaacatcactgcactccagacggcatttgaaaaaactgtggtg
ggggaggcaaaatcgtga

DBGET integrated database retrieval system