KEGG   Desulfobacca acetoxidans DSM 11109: Desac_1476Help
Entry
Desac_1476        CDS       T01454                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dao  Desulfobacca acetoxidans DSM 11109
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dao00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1681489..1682343)
Genome map
AA seq 284 aa AA seqDB search
MAPLHQLVIGKQTFDLAHRSLLMGVLNVTPDSFSDGGFFFSHDAAIQQALQLAADGADII
DIGGESTRPFAPPLSLQEELDRVIPVIRTIRRELDTLISIDTYKAAVAQAALEAGANLIN
DISALRFDPDMAPLAAQSGVPVVLMHMQGTPQDMQVDPHYNDLVGDIKTFLAQRRDFACA
QGIDPANIILDVGIGFGKTLAHNLELLQRLDEFRNLDCPLLLGVSRKAFIGRILHVPVTE
RDIGGLGAIILGLVRGANIIRTHNAAYAKQAIAVAEAILHSYPR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcttcaccaattggtcatcggtaagcaaacctttgacctcgcacaccgatca
ctgctcatgggggtcctcaacgttacgcccgactccttctctgatggcggctttttcttc
agccacgacgctgccatccaacaagccctgcaactagccgctgacggagctgatattatc
gatatcggcggtgaatcaacccgtcccttcgccccccctctctccctgcaagaggaactt
gaccgggttatcccggtaatccgaaccattcgccgggaattggatacactcatttctatt
gatacctataaagctgccgtggcccaagccgccttggaggccggcgccaacctcatcaac
gatatcagtgccttgcgatttgatcccgacatggcaccattagccgcacagtccggcgtt
ccggtcgtgctcatgcatatgcagggaaccccgcaagatatgcaggttgacccccactat
aatgacctggtaggtgatattaaaacctttctggctcaacgtcgggattttgcctgcgcc
caggggattgatccggccaatatcatcttagacgtcggcatcggcttcggtaaaaccctg
gcccacaatctcgaactgctccagcggctggatgaattccgcaatctggattgccccctg
ttgctgggagtctcgcgtaaggcctttatcggcaggatattacatgtcccggtaaccgaa
cgcgatatcggcgggttgggcgccatcatcctgggcctcgtcagaggggccaatatcatc
cgtacccacaacgcagcttatgccaagcaagcgatcgccgtcgctgaagctatcctgcac
agctatcctcgctag

DBGET integrated database retrieval system