KEGG   Desulfobacca acetoxidans: Desac_1975Help
Entry
Desac_1975        CDS       T01454                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desac_1975
   01230 Biosynthesis of amino acids
    Desac_1975
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_1975
   00051 Fructose and mannose metabolism
    Desac_1975
   00562 Inositol phosphate metabolism
    Desac_1975
Enzymes [BR:dao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desac_1975
Exosome [BR:dao04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desac_1975
  Exosomal proteins of bladder cancer cells
   Desac_1975
  Exosomal proteins of melanoma cells
   Desac_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2216282..2217046
Genome map
AA seq 254 aa AA seqDB search
MTEMRRPLIAGNWKMHLTLAESAALARTVRTDLKETAVAEVVLAPPFTALSVVAQELAGS
PVQLAAQDVFWELQGAYTGAISPRMLQDVGCRYVIIGHSERRQYFGETDATVNRKIKAVL
TVGLQPMMCIGETLAQREAEETLAVITSQLTGGLADLLPEEINRLVIAYEPVWAIGTGRT
ATPEQAQEVHSFIRQLLAKQVRPDIAYGLRLLYGGSVTPDNIKVLAQAPDIDGALVGGAS
LKADSFLKIAALGN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatgcgaagaccgctcatagcgggtaactggaagatgcacctgaccctggcc
gaatccgcggctctggcgcgaacggtgcgcaccgacctgaaagaaacggcagttgccgaa
gtggtgctggcaccgccttttaccgccctgtccgttgttgctcaagaactggcgggttct
ccagttcagttggcagcccaagacgtcttctgggaactacagggggcctacaccggggct
atctcgcccaggatgctgcaggacgtgggctgccgttatgttatcatcgggcattcggaa
cgacgacaatattttggcgaaaccgatgctaccgtgaaccgtaaaattaaggctgtttta
accgtcggtcttcagcctatgatgtgcatcggcgagaccctggcccaacgagaggctgaa
gagactctggcagtcataacttcccaattgacgggagggttggctgatctgctcccggaa
gagataaaccggttggtgattgcctacgaaccggtttgggccattgggaccggacgcacc
gccacccccgaacaggcccaggaggtccatagctttatccggcaactgctggcgaaacaa
gtgaggccggacatcgcctatgggttacgcctcctctacggcggcagcgtcacccctgat
aatatcaaggtgttggcccaagcgccggatatcgacggcgccctggtgggaggagcctcg
ctcaaagccgactcatttctcaagatcgccgccttgggaaattaa

DBGET integrated database retrieval system