KEGG   Desulfobacca acetoxidans DSM 11109: Desac_2012Help
Entry
Desac_2012        CDS       T01454                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dao  Desulfobacca acetoxidans DSM 11109
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dao03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2246163..2246759
Genome map
AA seq 198 aa AA seqDB search
MIAYLEGELFQKRPDYLIIKVGGVGYQTFIPLSTFYQLPEPPASVALHIHTQVQTDSLQL
YAFATLDEKQTFIKLLSIPRVGPRLALNILSGISPQDLAQTLIQGDIPRLAAIPGLGRKS
AERIMVELKGKLRPDATAVSALSSGPQGALWEDALSALINLGYSRTLAEEVLRHVQLHEK
PLTLEEILRLSLSRLASQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatatttagagggcgaactattccagaaaaggccggattatctgatcattaaa
gtcggtggggtcggctatcagacctttattcccctgtccaccttttatcaactgcctgaa
ccccccgcgtccgtagccctgcatatccatacccaggtgcaaaccgacagtctgcaactc
tacgccttcgctaccctggatgaaaaacagaccttcattaaactcctatcgattccccgc
gtcggaccccgactggcccttaacatcctctccggcatcagcccccaggatctggcccaa
actctgatacaaggggatatcccaagactggcggccatccctggattgggccggaaatcg
gctgaaaggatcatggtcgaactgaaaggcaagttgcgccccgacgcaaccgcggtatcg
gccctgtcctccggtcctcagggtgctctctgggaagacgccctctccgccctgatcaat
ctgggatattcccgcaccctggccgaggaagttttacgccacgtacaacttcacgaaaaa
cccctaaccctcgaggagatcctccgtctcagtctgagccgtctcgcttcccaataa

DBGET integrated database retrieval system