KEGG   Desulfobacca acetoxidans: Desac_2062Help
Entry
Desac_2062        CDS       T01454                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao00010  Glycolysis / Gluconeogenesis
dao00260  Glycine, serine and threonine metabolism
dao00680  Methane metabolism
dao01100  Metabolic pathways
dao01110  Biosynthesis of secondary metabolites
dao01120  Microbial metabolism in diverse environments
dao01130  Biosynthesis of antibiotics
dao01200  Carbon metabolism
dao01230  Biosynthesis of amino acids
Module
dao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dao_M00002  Glycolysis, core module involving three-carbon compounds
dao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_2062
  Energy metabolism
   00680 Methane metabolism
    Desac_2062
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desac_2062
Enzymes [BR:dao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Desac_2062
Membrane trafficking [BR:dao04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Desac_2062
Exosome [BR:dao04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Desac_2062
  Exosomal proteins of melanoma cells
   Desac_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEB09891
JGI: Desac_2062
UniProt: F2NJU7
Position
complement(2297560..2298312)
Genome map
AA seq 250 aa AA seqDB search
MYTVVLLRHGESVWNKENKFAGWTDVGLSPKGVQEAIEAGRYLKKEGYVFDLAFTSVLSR
AIKTLWLVLEEMDLMWIPVYHNWRLNERHYGALQGLNKVETVNTFGMEQTQIWRRSYDTP
PPPLTQDDPRWPGNDPRYASLKSEEIPLTECLKDTVARFLPYWHETIAPTIKTGKRVLIA
AHGNSLRALVKYLDQISDEAIVSLNIPTGIPLVYELDEGLKPIRTFYLGDPEKVQAAIQA
VANQLKGGKK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtatacagtcgttttgttgcgccatggcgagagcgtgtggaataaggagaataagttc
gccggctggacggatgtcgggttgtcgccaaagggcgttcaggaagccatagaggcaggc
cgttatctcaaaaaggaaggctacgtctttgatctggcgtttacttccgttctttctcgg
gccatcaagaccctgtggctggttttggaagagatggacctgatgtggatcccggtctac
cacaattggcgtttgaacgaacggcattacggtgctctccagggactcaataaagtggag
acggtcaataccttcggcatggagcagactcagatctggcgccgcagttatgacaccccg
cctccgccgctgactcaggatgacccccggtggccgggaaatgacccacggtatgcgtct
ctcaaatcggaagagatccccttgaccgagtgtttgaaagataccgtggcccgattcctg
ccttactggcatgagaccattgcccctaccatcaagaccggcaaacgggtgctcattgca
gctcatggaaacagcctcagggcgctagtgaaatatctggaccagatttcagatgaggcg
attgtctccctgaatatccctacgggaattcctctggtctatgaattagatgaaggtctt
aagcccatccggactttttacctgggcgacccagaaaaggtgcaggcagccattcaggcc
gtggccaaccaactcaaaggcgggaaaaagtaa

DBGET integrated database retrieval system