KEGG   Desulfobacca acetoxidans: Desac_2062Help
Entry
Desac_2062        CDS       T01454                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1 5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desac_2062
   01230 Biosynthesis of amino acids
    Desac_2062
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_2062
  Energy metabolism
   00680 Methane metabolism
    Desac_2062
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desac_2062
Enzymes [BR:dao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Desac_2062
Exosome [BR:dao04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Desac_2062
  Exosomal proteins of melanoma cells
   Desac_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2297560..2298312)
Genome map
AA seq 250 aa AA seqDB search
MYTVVLLRHGESVWNKENKFAGWTDVGLSPKGVQEAIEAGRYLKKEGYVFDLAFTSVLSR
AIKTLWLVLEEMDLMWIPVYHNWRLNERHYGALQGLNKVETVNTFGMEQTQIWRRSYDTP
PPPLTQDDPRWPGNDPRYASLKSEEIPLTECLKDTVARFLPYWHETIAPTIKTGKRVLIA
AHGNSLRALVKYLDQISDEAIVSLNIPTGIPLVYELDEGLKPIRTFYLGDPEKVQAAIQA
VANQLKGGKK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtatacagtcgttttgttgcgccatggcgagagcgtgtggaataaggagaataagttc
gccggctggacggatgtcgggttgtcgccaaagggcgttcaggaagccatagaggcaggc
cgttatctcaaaaaggaaggctacgtctttgatctggcgtttacttccgttctttctcgg
gccatcaagaccctgtggctggttttggaagagatggacctgatgtggatcccggtctac
cacaattggcgtttgaacgaacggcattacggtgctctccagggactcaataaagtggag
acggtcaataccttcggcatggagcagactcagatctggcgccgcagttatgacaccccg
cctccgccgctgactcaggatgacccccggtggccgggaaatgacccacggtatgcgtct
ctcaaatcggaagagatccccttgaccgagtgtttgaaagataccgtggcccgattcctg
ccttactggcatgagaccattgcccctaccatcaagaccggcaaacgggtgctcattgca
gctcatggaaacagcctcagggcgctagtgaaatatctggaccagatttcagatgaggcg
attgtctccctgaatatccctacgggaattcctctggtctatgaattagatgaaggtctt
aagcccatccggactttttacctgggcgacccagaaaaggtgcaggcagccattcaggcc
gtggccaaccaactcaaaggcgggaaaaagtaa

DBGET integrated database retrieval system