KEGG   Desulfobacca acetoxidans: Desac_2149Help
Entry
Desac_2149        CDS       T01454                                 

Definition
XRE family transcriptional regulator
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dao  Desulfobacca acetoxidans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desac_2149
   00052 Galactose metabolism
    Desac_2149
   00500 Starch and sucrose metabolism
    Desac_2149
   00520 Amino sugar and nucleotide sugar metabolism
    Desac_2149
Enzymes [BR:dao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desac_2149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2397576..2398823
Genome map
AA seq 415 aa AA seqDB search
MEKKPKLHFGHLMRQSREAAGISQRALAQQAGLDVSYINRLESGERRPRRGTLLKLASAL
RITGQELEAWLMAGDLAPTPLLASLRNQLGRTAVAAGPDVSGQTPEAETLSLWERLEASG
LDEVSLRRLLHNLAASDESLQKQSAAMVAAAVNLAADYLAAPVHRAIIPAAGGQHRLLAM
HVMQHLLLQMMGEAASAGVCQFMLILAPGTAETLYQPLQTALNLAVVPRFSLNFCVQEAP
RGLGDAVLQAASWVGQEPFLVLLPDEMLDRRRPHDMPRELQHMSTAFRQLNQAPLIAVEP
SSKARLPQGGVVRLGRLAIPPRIFQVEELVEKPATSNPIIDSPTSRSIVGRYFLPPQIFQ
TLEHLKGQGTPTLELTDALEYMRHQQTAVYAYELKTSRRDLGGVIERAEELIGEI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagccaaagctacacttcggccacctgatgcgccaatcccgggaggctgcc
ggaatcagccaaagggcgctggcccagcaggcgggtctggatgtcagttatatcaaccgc
ctggagagcggagaacgccgaccgcggcggggaacgctcctcaaactggcctcagctctc
aggatcaccggacaggaactcgaagcctggctgatggccggcgacctggcccctacgcct
ctattagccagtcttaggaaccaacttggccggacagcggttgccgcgggtcccgatgtt
agtggccagacacctgaggcagaaacgctctctctctgggaaagactcgaggccagcggc
ttggatgaggtcagcctgcgccgcctgctccataacctggccgcctcagatgaatcactc
cagaaacagtccgccgccatggtcgccgcagcggtaaacctggccgccgattatctggca
gcaccggtacatcgggccattataccggctgcgggcggccagcatcggctcctagccatg
cacgtcatgcagcatctgttgttacagatgatgggggaagcggcttcggcgggggtctgc
cagtttatgctgattctggcgccaggaacagcggaaacgctctatcaacctctacaaacc
gccctgaacctggcagtagtgccacgcttttccctgaatttctgcgtccaggaggcaccg
cgcggattgggcgacgccgtattgcaggccgcctcctgggtgggacaagaaccttttctg
gtcctgctgccggatgaaatgctcgaccggcgccgcccgcacgacatgccccgggaattg
cagcatatgagcaccgccttcagacagctcaaccaagcgcctttgattgccgtagagccg
tcttcaaaagcaagactgccgcaaggtggggtagtgcgcttaggcagactggcgatccct
ccccgcatcttccaggtggaagagctggtggaaaaaccggcgacatccaacccaatcatc
gactcccccacctcccgctctatcgtcggccggtatttcctgccgccacagatatttcaa
accttagaacacctaaagggccaggggacccctaccctggagttaaccgatgccctggag
tacatgcgccatcaacagacagcggtttatgcctacgagttgaaaacctcccgccgcgac
ctgggcggggtaatcgaacgggcggaagagttgatcggcgaaatctag

DBGET integrated database retrieval system