KEGG   Desulfobacca acetoxidans: Desac_2441Help
Entry
Desac_2441        CDS       T01454                                 

Definition
zinc-binding alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Desac_2441
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_2441
  Lipid metabolism
   00071 Fatty acid degradation
    Desac_2441
  Amino acid metabolism
   00350 Tyrosine metabolism
    Desac_2441
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desac_2441
   00626 Naphthalene degradation
    Desac_2441
Enzymes [BR:dao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Desac_2441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2715165..2716169)
Genome map
AA seq 334 aa AA seqDB search
MQAMVLEFPAPIGSNPLHLVELPPLLPGPGELMIEISYCGVCHTDLHIVEGELPLARLPL
VPGHQVVGRVKELGPRTKRFQVGDRVGLAWFHWACGNCRFCAKGLENLCEQAQFTGYHRD
GGYAQMTVAPADFAYRLPENFPDLEAAPLLCAGIIGYRALRLSEIKPGGRLGLYGFGASA
HIAIQVARYWNCEVFVFTRSPGHQELARKLGAAWVGQAQDLPPAPLDSAIIFAPAGSLVP
EALRVLDKGGVLALAGIYMSQIPSLDYEKHLYYEKTVRSVTASTRRDGEELLRLAAEIPI
HTETQVFDLAEANKALQLIKAGKINGAAVLAINP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccatggtcttggaattccctgcgcctatcggcagtaatcccctccatctggta
gagctccccccgctgttgccgggaccgggggagctgatgatagagataagttattgcggc
gtctgtcacactgatctgcatatcgtagagggggagctacctctggcccggctgccactc
gttcccggtcatcaggtggtcggtcgggtgaaggagttgggaccgcgtaccaagcggttc
caggtcggtgatcgggtagggctggcctggtttcactgggcctgcggcaactgtcgtttt
tgtgccaaaggtctggagaacctgtgcgaacaggcgcagtttaccggttatcaccgcgat
ggcggctatgcccagatgaccgtggcgccggctgattttgcgtatcgcctgcccgagaat
tttcccgacctggaggcggcgccgctgctctgcgccggcattatcggctaccgggccctt
cggcttagtgagatcaaaccgggggggagattggggctgtatggttttggtgcttcggcc
catatcgccatccaggtggcccgttactggaactgtgaagtctttgtctttacccgcagt
cctggccaccaggagttggcccggaaactgggggccgcctgggtgggacaggcccaggac
cttccgccggcccccctggacagcgccatcatcttcgcccccgccggcagcctggtcccg
gaggcattacgggttttggataaaggcggcgttctggccctggccggtatctatatgtca
cagattccgtctttggattatgaaaaacatctttattacgagaaaaccgtgcgttcggtg
actgccagtacccgccgggacggcgaggaactcctccggttagcggcggagattcctatc
cacaccgaaacccaggtctttgaccttgccgaggcaaacaaggccctgcagcttatcaaa
gccggaaagatcaacggtgccgcggtattggccattaatccataa

DBGET integrated database retrieval system