KEGG   Desulfobacca acetoxidans: Desac_2448Help
Entry
Desac_2448        CDS       T01454                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
dao  Desulfobacca acetoxidans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desac_2448
DNA repair and recombination proteins [BR:dao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desac_2448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2724888..2725493
Genome map
AA seq 201 aa AA seqDB search
MARNFYPAPLQKVIRGLSRWPGIGEKTATRLALYLLRAADTEVTELAQALIDLKAKIRLC
SRCFAFADQELCPICADPGRNNGQLVVVADPGDLIALERVGFFQGAYHVLGGLISPLDNV
GPRDLHISELLSRLHSEAIEEVILALNPSLEGEATTAYLAQELQGKPVKVTRIAYGLPMG
GDLKYADQQTIKESLRHRVRA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaatttctatcctgcacctctgcagaaggttatccggggacttagcagatgg
cctggaatcggcgaaaaaaccgccacccggctggccctctacttactacgggcggcagat
accgaagtaaccgaattggctcaggccctgatcgacttgaaggctaagatcaggctctgc
tcccgttgttttgcctttgccgaccaggaactttgccccatctgcgctgatccggggcgg
aataacggtcagctggtggtagtggccgatccgggggacctgatcgccctggagcgggtc
ggtttttttcaaggcgcatatcatgttctgggcggcctcatctcccctctggacaacgtt
ggaccgagggatttgcatatttccgagcttttgagccgcttgcactccgaagccattgaa
gaggtcatcctggccttgaatccgagcctcgagggggaggcgacaacggcttatctggcc
caagagctgcagggcaaaccggtaaaagtaacgcggattgcctatggtctccccatgggc
ggcgatttgaagtacgccgaccaacagactattaaagagtcgttgcggcatcgggtgagg
gcgtga

DBGET integrated database retrieval system