KEGG   Desulfobacca acetoxidans: Desac_2680Help
Entry
Desac_2680        CDS       T01454                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desac_2680
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desac_2680
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desac_2680
Enzymes [BR:dao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desac_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2955649..2956830
Genome map
AA seq 393 aa AA seqDB search
MLPDKQGHFGQYGGRFVPETLMPALLELEEAYGRIKRDPDFKKELAGLLKDYVGRPSPLY
FAKHLTAELGGPKVYLKREDLNHTGAHKINNTLGQGLLAQRMGKKRVIAETGAGQHGVAT
ATIAALLGMECDIYMGTEDIRRQRLNVIRMKLLGARVIPVESGSCTLKDAMNEAIRDWVT
NVRHTHYVIGSVAGPHPYPRLVRDFQSIIGQEAKAQIRQQEGRLPDCLVACVGGGSNSMG
LFYPFLKDPVRFIGVEAAGHGIETGRHSATLVAGSVGVLHGACSYLLQDPWGNICEAHSL
APGLDYPGVGPEHSYFKDTGRAQYVAIDDEETLQGFKLLSQTEGILPALESSHAVAYVQK
AAKDFKKDEIVIINLSGRGDKDVEAVAEILEKI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgttacctgataaacaaggtcatttcggtcagtacgggggccgttttgtaccggagaca
ttgatgccggcccttttggaattagaagaggcctatggccgcatcaaacgggacccggat
tttaaaaaagaactggccggattgttgaaagattacgtcgggcggccatcgccgctctat
tttgccaaacacctgaccgccgagttaggcggaccaaaggtgtatttaaaacgggaggac
ctcaatcacaccggcgcccacaagatcaataacaccctggggcagggattgttggcgcag
cggatgggcaaaaagcgggtcatcgccgagaccggggctggccaacacggcgtcgccacg
gccacgatcgccgccctcttgggcatggagtgcgatatctacatgggaacggaggacatc
cgccgacagcggctgaacgttatccgcatgaaactgttgggcgcccgagtcataccggta
gagtccggcagttgcaccctcaaggatgctatgaacgaggccattcgggattgggtgacc
aatgtgcggcacacccactacgttatcggatccgtggccgggccccatccgtatccccgc
ctggtgcgcgacttccagtcgatcatcggccaggaggccaaggcccagatacggcaacag
gaagggcggttgccggattgcctggtagcctgcgtgggcggcggcagcaactccatgggg
ctgttttatccgttcttaaaggacccggtacgattcatcggcgttgaggccgccggccac
ggcatcgagacggggcggcactcggcaaccctggtcgccggcagcgtcggcgttttgcac
ggggcctgcagctacctcctccaggatccctggggcaacatctgcgaagcgcactcactg
gcaccgggactggattatcctggtgtcggaccggaacattcttatttcaaggataccggc
cgggcgcagtatgtggccatcgacgacgaagaaaccctgcagggtttcaaactgctttct
cagaccgaaggcattctgccagccctggaaagctcccatgccgtggcttacgtccagaag
gcggctaaggattttaaaaaagatgaaattgtcatcatcaacctttccggccggggagac
aaagacgtagaagcggtggccgagattctggagaagatatga

DBGET integrated database retrieval system