KEGG   Desulfobacca acetoxidans: Desac_2681Help
Entry
Desac_2681        CDS       T01454                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desac_2681
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desac_2681
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desac_2681
Enzymes [BR:dao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desac_2681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2956827..2957618
Genome map
AA seq 263 aa AA seqDB search
MKKINAMFKRLAAMGGKALIPYITAGDPDLKTTHDLVLEMARRGADLIELGIPFSDPLAD
GPTIQAACQRALKQEVNLTKILTLVQSLRQDTDIPLVLMGYYNPILSYGLARLARDAAEI
GVNGFIIPDLPGEEARDWHRAACDAGVAPIYLAAPTSGPSRIRKIGALTRGFLYYVSVTG
ITGARAGLPDDLKTSLAEVRSLIKCPLAVGFGISTPEQVRDLAPYVDGIVVGSAIVQRIA
CRTGREVVQDIGDFVAELKAPLR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcaacgccatgtttaaacggctggcggcaatgggaggaaaggccctcata
ccctatattaccgcgggggatccagatctgaagacgacccatgacctggtattggaaatg
gcccggagaggcgccgatctcattgaactgggtatcccattctccgatccactggccgac
ggccctaccatccaggccgcctgccaacgggccctcaaacaggaggtcaacctgaccaaa
atcttaacgctggtacaatcgctccgccaggataccgacatacccctggtgctcatgggg
tattataaccccatcctttcttatgggctggcgcggctggcccgcgacgctgccgaaatc
ggggtgaacggctttatcatcccggatctcccaggcgaagaggccagagattggcatcgc
gccgcctgcgacgcgggggtggcgcccatttatctggccgcacctaccagcggtcccagc
cgcatccggaagatcggcgccttgacgcgaggctttctgtactatgtctcagtgacgggt
attaccggcgcccgggcgggcctgcccgatgacctcaaaacctctctggcggaggtgcgc
agcctgatcaagtgccccctggcggtcgggtttggcatctctacaccggagcaggtccgg
gacctggctccatatgtagacggcattgtggtgggcagcgctattgtgcaacggattgcc
tgccggacaggtcgagaggtagtgcaagatatcggcgactttgtggctgagctaaaggcg
ccattgcgatag

DBGET integrated database retrieval system