KEGG   Desulfobacca acetoxidans DSM 11109: Desac_2681Help
Entry
Desac_2681        CDS       T01454                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dao  Desulfobacca acetoxidans DSM 11109
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dao01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dao00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dao00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2956827..2957618
Genome map
AA seq 263 aa AA seqDB search
MKKINAMFKRLAAMGGKALIPYITAGDPDLKTTHDLVLEMARRGADLIELGIPFSDPLAD
GPTIQAACQRALKQEVNLTKILTLVQSLRQDTDIPLVLMGYYNPILSYGLARLARDAAEI
GVNGFIIPDLPGEEARDWHRAACDAGVAPIYLAAPTSGPSRIRKIGALTRGFLYYVSVTG
ITGARAGLPDDLKTSLAEVRSLIKCPLAVGFGISTPEQVRDLAPYVDGIVVGSAIVQRIA
CRTGREVVQDIGDFVAELKAPLR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcaacgccatgtttaaacggctggcggcaatgggaggaaaggccctcata
ccctatattaccgcgggggatccagatctgaagacgacccatgacctggtattggaaatg
gcccggagaggcgccgatctcattgaactgggtatcccattctccgatccactggccgac
ggccctaccatccaggccgcctgccaacgggccctcaaacaggaggtcaacctgaccaaa
atcttaacgctggtacaatcgctccgccaggataccgacatacccctggtgctcatgggg
tattataaccccatcctttcttatgggctggcgcggctggcccgcgacgctgccgaaatc
ggggtgaacggctttatcatcccggatctcccaggcgaagaggccagagattggcatcgc
gccgcctgcgacgcgggggtggcgcccatttatctggccgcacctaccagcggtcccagc
cgcatccggaagatcggcgccttgacgcgaggctttctgtactatgtctcagtgacgggt
attaccggcgcccgggcgggcctgcccgatgacctcaaaacctctctggcggaggtgcgc
agcctgatcaagtgccccctggcggtcgggtttggcatctctacaccggagcaggtccgg
gacctggctccatatgtagacggcattgtggtgggcagcgctattgtgcaacggattgcc
tgccggacaggtcgagaggtagtgcaagatatcggcgactttgtggctgagctaaaggcg
ccattgcgatag

DBGET integrated database retrieval system