KEGG   Desulfobacca acetoxidans: Desac_2709Help
Entry
Desac_2709        CDS       T01454                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dao  Desulfobacca acetoxidans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desac_2709
Enzymes [BR:dao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Desac_2709
Exosome [BR:dao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desac_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2990680..2992659)
Genome map
AA seq 659 aa AA seqDB search
MKKKKTISTSSAPGTVTPAPIPVGPVRYDISRLTDDDLFIFNEGNHFRLYDKFGAHCMEA
DGVRGVYFAVWAPDAERVLVIGDFNGWHKESHPLGSRGQSGIWEGFIPGVVKGAKYKYYI
HSRYNGYRVEKADPFSVFYEGPPRMASIIWELDYAWGDQDWLAERHRRNSLKSPISIYEV
HLGSWMRIPEDANRSPSYREIAPKLAHYVQEMGFTHVEFLPVMEHPFYGSWGYQTTGYFA
PTSRYGNPQDFMYLVDLLHQRGIGVILDWVPSHFPADEHGLGYFDGTHLYEHADMRKGFH
PDWNSYIFNYGRNEVRSFLLSSAFYWLDKHHADGLRVDAVASMLYLDYSREEGEWIPNIY
GGKENIEAIWFLRKFNEEVYKNFPDVQTIAEESTDWSMVSRPTYLGGLGFGLKWDMGWMH
DTLQYLTHDPIHRRYHHNTITFRMLYAFTENFVLPLSHDEVVHGKGSLIHNLPGDYWQKF
ANLRLLFGYMYGQPGKKLLFMGMEFGQWNEWYHETSLDWHLLDFPSHAGVQRWLADLNRT
YRQQPALYEVDFNWTGFEWIDCNDVDASVITFLRQGQRPEDVVLVACNFTPVPRFNYRTG
VPHGGFWKELLNSDALEYGGSGLGNAGGLYADPWPHHGRPFSLNLTLPPLAVVFLKVAG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaagaaaaccatttcaacgtcttccgcccccggcacggttaccccggctccg
atccctgtgggtccggtgcgctatgacatctcccggctcaccgatgatgatctgttcatt
tttaacgaaggtaatcatttccggctctacgataaatttggggcgcactgtatggaggcc
gacggtgtccggggggtgtattttgccgtttgggcgccagatgccgagcgcgttctggtc
atcggggattttaacggttggcacaaagaatcgcaccccttgggttcccgcgggcaatcg
ggcatctgggagggttttatcccaggggtagtgaaaggggcaaagtacaaatattatatc
cattcccgctacaacggctaccgggtggagaaggccgaccccttttcggtattttatgag
ggtccgcctcgcatggcctcgatcatctgggaactggattacgcctggggcgatcaggat
tggctggccgagcgccatcgccgcaactctttgaagagccccatatctatttacgaggtg
catctgggttcctggatgcggatccccgaggacgccaatcgttcaccgagttatcgggag
atcgctcccaaactggcccactatgtccaagagatgggtttcacccacgtagaatttctg
ccagtcatggagcaccccttctatggttcctggggctatcagaccaccggttattttgcc
cccaccagccgctatggcaatccccaggatttcatgtatctggtagacctgctgcaccag
cgcggtatcggggtcattttggattgggtgccgtctcactttccggccgatgaacacggt
ctgggttacttcgatggcacgcatctttacgagcacgccgatatgcgcaaaggcttccat
ccggactggaacagttatatctttaattatggccgcaatgaggtccgcagcttcctcttg
agcagcgctttctattggctggataaacaccacgccgacggtctcagggtagacgccgtg
gcttccatgctctatctggactattcccgcgaagaaggggagtggattcccaatatctat
ggcggcaaggagaatatcgaggccatctggtttctgcgcaagttcaatgaagaggtctac
aagaactttcctgacgtgcagactattgcagaggaatccaccgattggtccatggtctcc
cgcccgacctacctgggcggtttgggcttcgggctgaagtgggacatgggctggatgcac
gacaccttacaatacctgactcatgaccccattcaccggcgttatcaccacaataccatc
accttccgcatgctctacgccttcaccgaaaactttgtgctgcccctttcgcatgacgaa
gtggtgcatggcaagggttccttgattcacaacctgccgggcgactattggcagaaattt
gccaacctgcgcctgctcttcggctatatgtatggccagccggggaaaaagctcctgttt
atggggatggagttcggccaatggaatgaatggtaccatgaaaccagccttgactggcat
ctgctggactttcccagccatgcgggcgtacagcgttggctggccgacctgaaccggacc
tatcggcagcaacccgccctttatgaagtagatttcaactggaccggctttgaatggatc
gactgcaatgacgtggacgccagcgtcatcacctttctgcgccagggccagcgtcccgag
gatgttgtcctggtggcctgcaatttcacgccggtgccccgctttaactaccgcacgggc
gttcctcacggcggcttctggaaagaattactcaacagcgacgccctcgagtatgggggc
agtggcttgggtaatgccggcggcctctacgccgacccctggccgcatcacggacgcccg
ttctctctcaacctgacgttgccgccattggcggtggtctttttaaaagtggctggctaa

DBGET integrated database retrieval system