KEGG   Desulfobacca acetoxidans: Desac_2907Help
Entry
Desac_2907        CDS       T01454                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dao  Desulfobacca acetoxidans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desac_2907
   01230 Biosynthesis of amino acids
    Desac_2907
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_2907
   00030 Pentose phosphate pathway
    Desac_2907
   00051 Fructose and mannose metabolism
    Desac_2907
   00052 Galactose metabolism
    Desac_2907
  Energy metabolism
   00680 Methane metabolism
    Desac_2907
Enzymes [BR:dao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desac_2907
Protein phosphatases and associated proteins [BR:dao01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desac_2907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3212420..3213703
Genome map
AA seq 427 aa AA seqDB search
MVDIKDFEVETLGECRVDTPIESARFVEDDDHVMFHYCLKDLQAYFEAGQTPPYFEMAGP
RRNIYFDPSKLKCGIVTCGGLCPGINDVIQAMVMELYYHYGVRSIFGFRYGFEGLAPKYK
HSPLELNPDVVTDIYLQGGTILGSSRGEQNVPEMVDTLERMNLGLLFAIGGDGTLRGAQA
ISQEIKRRNLKIGVIGIPKTIDNDISYVQNSFGFITAISEARTAIYTAHIEALGARNGIG
LVKLMGRESGFIAAYATLANADVNLCLVPESPFSLEGLMAEIQNRLERRSHAVIVVAEGA
GQEFFQATSETDASGNVRLGDIGVFLKEKINQHFKKIGVDITLKYIDPSYTIRSVRANPY
DSYFCLTLGHQAAHAGMAGRTNMLVGYWNGQFTHMPISLAVSARKRIDPKGRLWNEVLAS
TGQPRTM
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggttgatataaaagattttgaggttgagactttgggggagtgtcgcgttgacacccct
atcgaaagcgcccgttttgtagaagatgacgatcatgtcatgttccattactgccttaaa
gacctgcaggcttattttgaggctggtcagacgccgccttattttgaaatggcggggccg
cgccgtaatatttatttcgacccttccaaacttaaatgcggcattgtcacctgcggaggg
ctctgtccggggattaatgatgttatccaggcaatggtgatggaactctattaccactac
ggggttcgctcaattttcggtttccgttatggatttgaaggtctggcgcccaaatataaa
cattcacccctggagctcaacccggatgtggtcaccgatatttacctgcagggtggcacc
atcctcggttcctctcgaggcgaacaaaacgtccccgaaatggtggataccctggaacgg
atgaatttaggtctgctgttcgccatcggcggtgacggcaccctaagaggcgcccaggcc
atctcgcaggaaattaagcggcggaatctcaagatcggcgtcatcggcatacccaaaacc
atcgacaatgatatttcctatgtccaaaactccttcggttttattaccgcgatttccgag
gcccggacagccatctataccgcccacatcgaagccttgggagcccgcaacggcatcggc
ctggtgaaactcatgggccgtgagtcaggctttatcgccgcctacgccaccctggccaac
gccgatgtcaatctctgcctggtgccggagtcgcccttctcgctcgaaggtctgatggcc
gagatccaaaaccggttagaaagacgcagccatgcggtcatcgtcgtcgccgaaggcgcc
ggccaggaattcttccaggctaccagcgaaaccgacgcctccggtaatgtccgcttgggc
gatatcggcgtctttctcaaagagaagatcaatcagcactttaaaaaaatcggggtggat
atcacccttaaatatatcgacccgagctataccatccggagcgtgcgagccaatccctac
gattcctacttctgtttgactctcggacatcaggcagcccacgccggcatggccggccgc
acaaatatgttggtgggttactggaacggccagttcactcatatgccgatatctctggct
gtctccgcccgcaaacgcatcgaccccaaaggtcgattgtggaatgaggtgctggccagt
accggtcagccccgcaccatgtaa

DBGET integrated database retrieval system