KEGG   Denitrovibrio acetiphilus: Dacet_0069Help
Entry
Dacet_0069        CDS       T01189                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dacet_0069
Enzymes [BR:dap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Dacet_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
63454..64296
Genome map
AA seq 280 aa AA seqDB search
MNEISLKSYGKINIFLHVLGKRSDGFHELFTLFSKIALHDTLNIKKSVSQRIVCSKKSIP
TDDSNIINRVHKILTEKHGVTQNFETELIKRIPDGGGLGGGSSNGAAYLNGVCDLLELEM
SMSVKTSVMASVGSDTAFFLHDEPMIGRGRGEILEPYGSLPECALVLVNPKEHVPTGTVF
TSGNLKLTHDKEVNRMRHISDYEEYGDVLFNGLEEAVFKLYPAVEEAKSSLLDAGADFAL
MSGSGATVFGICRDKGCASRTADMIKSRHPAWDVFITELI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagatatccctgaaaagttacggaaagataaatatttttctacatgttttaggg
aaaagatcagacggttttcatgaacttttcacccttttttccaaaatagcacttcacgac
acactgaatataaagaaatcagtttcccagcgaatagtgtgctcaaaaaagagtatccca
acagatgatagcaatatcataaatcgtgttcataagatacttactgaaaagcatggcgta
actcagaactttgaaactgagcttataaagcgtatacctgacggtggcggtcttggcggt
gggagcagcaacggagcagcatatcttaatggtgtttgtgatctccttgaacttgaaatg
tccatgtctgttaaaacatctgtaatggcatcagtgggttcagacacagctttctttctg
catgatgagccaatgataggcaggggtagaggcgaaatattagagccgtacggcagcctg
cctgaatgcgcgctggtgctggtgaacccgaaagagcatgttccgaccggaactgttttt
acatcaggaaatttaaagttgactcatgataaagaagttaatagaatgcgccacatatca
gactatgaagaatacggagatgttctttttaacggactggaggaagcagtttttaagctt
tatcctgccgttgaggaagctaagagttcgctgcttgatgcaggtgcggattttgcgctg
atgagcggaagcggtgctacggtttttggtatatgcagagacaaggggtgtgcctcgcga
accgctgatatgataaaaagcagacatcctgcgtgggatgtttttattacagaattaata
tag

DBGET integrated database retrieval system