KEGG   Denitrovibrio acetiphilus: Dacet_0310Help
Entry
Dacet_0310        CDS       T01189                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dacet_0310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dacet_0310
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dacet_0310
Enzymes [BR:dap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dacet_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(324812..326164)
Genome map
AA seq 450 aa AA seqDB search
MKKIYLNPSDMPTQWYNILADLPQLAPPISPATGKPATPEEMLAIFPGPILEQEMSAQRH
IDIPEEVLDILTIWRPSPVVRAERLEKALGTKCRIYYKYEGGSPAGSHKTNTAVPQAYYN
KISGINKLTTETGAGQWGSALSYATSIFEMSLRVYMVKVSYFQKPYRKSFMNMFGAEVIP
SPSNLTNAGRAELERDPQSHGSLGLAISEAVEEAASNSDTNYALGSVLNHVIIHQSLIGL
EAKKQMEIGGDYPDMVFASCGGGSNFGGIAAPFVKDKMDGKKVECVAMEPISCPTLTKGE
YTFDYGDVGKMTPIMQMYTLGHDFMPPAIHAGGLRYHGDSPIVSAMYKQGLIDARSIGQL
DVFKYGTLFAKTEGIIPAPESSHAIAGAAKEALACDERGESKSLLFCLSGHGHFDMASYD
AYYEGKLEDYSYPEEEIEKSLRSLPKVDLD
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttatctgaatccaagcgatatgcccacacaatggtataacatattggca
gacctgccgcagcttgcaccgcccataagccctgcaacaggcaaaccggccacaccggaa
gagatgcttgcaatcttccccggacctatccttgagcaggaaatgagcgctcagcgccac
atagacatacctgaagaagtgctggacatactcacaatatggcgtccttcacccgttgtc
cgtgccgaaagactcgaaaaagcactgggtacaaagtgcagaatctattacaaatacgaa
ggcgggtcgccggcaggcagtcacaaaacaaatacggctgttccacaggcatattataat
aaaatatcaggtatcaacaaactgaccactgaaacaggtgccggtcagtgggggagtgcg
ctgtcttatgccacatcgatctttgagatgtctctcagggtttatatggttaaggtcagc
tacttccagaaaccatacagaaaatctttcatgaacatgttcggagcagaggttatcccc
tcgccttccaacctgacaaatgcaggacgggcggaacttgagcgcgaccctcagtcacac
ggctcactcggtcttgctatcagcgaagcagtggaagaggcagcgagcaacagcgacacc
aactacgctctaggctctgtactgaaccacgtaataatacatcagtcactcatcggactg
gaagctaaaaaacagatggaaatcggaggggactaccctgatatggtctttgcatcatgc
ggcggcggttcaaacttcggcggcattgcagccccttttgtcaaagataaaatggacggc
aaaaaagtcgagtgtgttgccatggagcctatctcatgccctactctgaccaaaggtgaa
tacactttcgattacggtgacgtgggcaagatgacacctattatgcagatgtatactctc
ggtcacgactttatgcctcctgctatccatgcaggcgggctcagataccacggcgacagc
cctattgtaagcgctatgtataagcaggggctgatagatgcaagaagcatcggtcagctg
gatgtcttcaaatacggcacacttttcgcaaaaacagaaggaatcatccccgcaccggaa
tcatcccatgccatcgcaggagcagcgaaagaagctctggcatgtgacgaaagaggcgaa
tccaaatcgctcttattctgcctttccggtcacgggcattttgacatggcatcctatgat
gcatattacgaaggcaaacttgaggattactcctacccggaggaagagatagaaaaatct
ctcagaagccttcctaaagttgatctagactaa

DBGET integrated database retrieval system