KEGG   Denitrovibrio acetiphilus: Dacet_0409Help
Entry
Dacet_0409        CDS       T01189                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dap01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:dap00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
414543..415817
Genome map
AA seq 424 aa AA seqDB search
MIIRKDDKRLQDILKRGEIMEGEYLHTVLDIIADVRTRGDESLAELTLRFDGYDMLKGGI
EISKREMKDAWEALDDRLKLALENAKANVISFHEKQLENTWIYEKTPGTFLGQKVTALES
VGVYVPGGKAVYPSSVLMNVLPAKVAGVEEIVMVTPATGGKVNPVVLAAAYLAGVDRGFR
IGGAQAIAALAYGTASVPRVNKIVGPGNIYVALAKKMVFGQVDIDMIAGPSEILIVADSS
ADPDHVAADMLSQAEHDELASAIVVTDDLELAKEIESSVYAQLEELPKREIAKKSIEKYG
AIIVTDDLNEAADITNNIAVEHLELCVANPMEYMLKIRNAGAIFLGANSPEPVGDYYAGP
NHVLPTGGTAKFFSPLGTYDFQKKSSIIYYSREQLIADMPDIRVLAESEELIAHRNSVII
RTED
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgattattagaaaagatgacaaaagacttcaggatattttgaaaagaggcgagattatg
gagggtgaataccttcatactgtgctggacataatagcagatgtcagaaccagaggggat
gagagcctcgctgagctgacactccggtttgacggatatgatatgctgaaaggcggcatt
gagatcagcaaacgggagatgaaggacgcatgggaagcccttgacgacaggctgaagctt
gctcttgaaaacgcaaaagcaaatgtgatctctttccatgagaagcaactggaaaataca
tggatttatgagaaaacacccggtacttttctggggcagaaggttacggcgcttgagtct
gtgggggtctatgtccctggcgggaaagctgtttatccttcgtctgtcctgatgaacgtt
cttcctgctaaggttgcaggtgtggaggagatcgttatggttacgcctgctacaggcggc
aaagtcaaccctgttgtgctggctgcggcttatcttgccggagtggatagagggtttcgt
atcggaggtgcgcaggctatcgctgcacttgcgtatggaacagcaagcgtaccgagagtt
aataagatcgtagggccggggaatatatatgtcgcactggcgaagaagatggttttcggt
caggttgatatcgatatgatagcgggaccgagcgagattcttattgtggcagatagttcg
gcagaccccgaccatgtggcagcagacatgctttctcaggcggaacacgacgaacttgcc
tcagcgatagtggtaactgacgatttggagcttgcaaaagagatagaaagttccgtttac
gcacagcttgaggaacttccgaagagagaaatagcaaagaaatcaatagagaaatacggt
gctataatcgttacagatgaccttaacgaagcggcggatattacaaacaatatagctgtt
gagcaccttgagctttgcgttgctaaccctatggaatatatgctgaaaatacgcaatgca
ggggcgatattcttaggagcaaattcaccggagcctgtcggcgattattatgcaggccct
aaccatgtgctcccaaccggcggtacagcaaagtttttctctccgctcggtacttatgac
tttcagaaaaaatccagtattatctactattcaagagaacagcttattgctgatatgccg
gatataagggtgcttgcggaatcagaagagctgattgcccacagaaattctgtaataata
agaactgaagattga

DBGET integrated database retrieval system