KEGG   Denitrovibrio acetiphilus: Dacet_0444Help
Entry
Dacet_0444        CDS       T01189                                 

Definition
Protein-L-isoaspartate(D-aspartate)O-methyltrans ferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dap  Denitrovibrio acetiphilus
Brite
Enzymes [BR:dap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dacet_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
457038..457652
Genome map
AA seq 204 aa AA seqDB search
MKNVNIPESYIKQAVGPACEWDKDIIDAFLSTPRHRFLDEAMLKMAYRDDALPIGYGQTI
SKPSTVAYMTKKLEVSEEHTVLEIGSGSGFQAAILSKLCKTVYTVERVPELHRRAYQIIK
RIPLRNVKMKLEPFKLGWSEFGPYDRIIATAEGKSVPDELVAQLADGGLMLVPADGKLMR
VTRNGNDIQAKPLANCSFVDFVGA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgtaaacatcccggaatcatacataaagcaggctgtcggtcctgcgtgcgaa
tgggacaaggatataatagacgcctttttgagcactcccagacataggttccttgacgaa
gctatgcttaagatggcttacagagacgatgctcttccgataggctacggtcagactatt
tctaaaccgtctactgtggcttatatgactaaaaaacttgaagtatccgaagaacatact
gtacttgagatcggcagcggatcagggtttcaggcggcgatactctcaaagctctgtaag
acagtatacactgttgagcgggttcctgagctgcacaggcgtgcatatcagatcatcaag
cgcattcctctgcgcaacgtgaaaatgaagctggagccatttaagctgggctggtctgag
tttggtccttatgacagaattatagctacggcagagggtaaatctgtgccggatgagctt
gttgcacagcttgctgatggtgggcttatgctggttcccgctgacggaaagctgatgcgt
gtaaccagaaatggtaatgatattcaggcaaaacctctggcgaattgcagttttgtggat
tttgttggagcgtaa

DBGET integrated database retrieval system