KEGG   Denitrovibrio acetiphilus: Dacet_0475Help
Entry
Dacet_0475        CDS       T01189                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dacet_0475
Enzymes [BR:dap01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dacet_0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487625..488203
Genome map
AA seq 192 aa AA seqDB search
MIYSVRGILIEKNPANAVIDTGAVAFEMSISASTYQQLPETGQKAHVYTHFVMREDGVYL
YGFSKMEEKKLFLLLITISKVGPKLALAILSGMDVNKFMNAVMNSEIGLISTIPGIGKKT
AERIVVELRDKFGSMSVSTGDEPVAGGAEDVVSALLNLGYSRADCQKAVNKIYKTDSGFE
ELFKGALKELSS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgatttatagcgtaagaggtatactcatagagaaaaatcccgctaatgctgtcattgac
acaggggcagttgcgtttgaaatgagtatttccgcatcaacttatcagcagctccctgag
accggacagaaggctcatgtttatactcattttgtaatgcgtgaggatggagtttatctg
tacggattttctaaaatggaggagaagaagctctttcttctgcttattactatatcgaaa
gtcggaccgaagctggcacttgccatactttccggtatggatgtcaacaaattcatgaat
gccgttatgaacagtgagataggtcttatctccaccattccggggatcgggaaaaaaaca
gcggaacgcatagtggttgagcttcgcgataaattcggcagcatgagtgtctctacaggt
gacgagcctgttgcaggcggtgcggaggatgttgtgagtgccctgcttaatctcggttat
tcacgtgcagactgtcagaaagctgtgaacaaaatttataaaaccgactccggctttgaa
gaacttttcaaaggtgcacttaaagagctcagttcgtag

DBGET integrated database retrieval system