KEGG   Denitrovibrio acetiphilus: Dacet_0941Help
Entry
Dacet_0941        CDS       T01189                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Dacet_0941
Enzymes [BR:dap01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Dacet_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985303..987882
Genome map
AA seq 859 aa AA seqDB search
MSKVRNVFLLFSLFVFVTGASASTLQDIMKQRNLSEKDILAAAKTYQPSGRKDEFITFSS
GGQSGQVIVYGVPSMRIYKYIGVFTPEPWQGYGYDNESKKVLEGGNFRGKKITWGDSHHP
ALTEKNGEYVGDYLFINDKANPRIAVIDLKDFETVQIVTNPIMKSEHGGAFVTPNSEYII
EATQYAAPLDDQWHPIEDYENSFRGALTMWKFDYDKGRINTDKSFSLELPPYMQDLSDAG
KGVSNGWGFINSFNSEMYTGGIEKGLPPFEAGMSRNDNDYLHIFNWKILEKLAEDEKNYK
IYNGHRVISMEAAIKAGALFLIPEPKSPHGVDVSPDGRFLIVCGKLDTHASVYDFNKIKG
LIDKKEFIGKDPYGIPILDMKKTLHGQVELGLGPLHSSFVPEEGVLYTSLYVDSQIVKWD
YKNLKVLDRINVHYNIGHVDAMEGKSAKPAGKYVIALNKLSIDRFNPVGPLHPQNHQLID
ITGPKMELLYDMPIPLGEPHDVVTIAASKLKPKKTYDMGSDSRTGKPHPDATLAGSERIE
RNGKNVKVYATMVRSHINPEHITVNKGDVVTIVVTNLERAQDETHGFGVDGMNVHASVEP
GKTASVTFVADQEGVFPYYCTEFCSALHLEMMGYLFVKDPDKKYEDIKKTQLKKMSQEEL
MAEYKKIIATNKATDDVIQSVVKYLKDNNYQKYSSIERLVVDALDQYGKIPEVKAKADDA
YNKGNLDEAILWENQVWQYMVKTADVGLRAKNNLARTIATPMSDAAARGELAYLEGGCNG
CHVIGQVSSGPDLTGSIWRTNEKWVWEFIKDPAPKYNEPYVKEYIDYFNLRMPNQNMSDK
EVDDIVEYMKWIDENADLF
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagttaggaatgtatttttgctgttttctctttttgtctttgtgacaggtgct
tcagccagcacattgcaggatattatgaaacagcgcaacctgtcagaaaaggatattctg
gcagcagcaaaaacttatcaaccttctggtagaaaagacgaatttattaccttttcttcc
ggtggtcaatcaggtcaggttatagtttatggtgttccctctatgaggatttacaagtac
ataggagtatttacacctgaaccgtggcagggttacggctatgataatgaatccaaaaaa
gttttagaaggtggcaatttcagagggaagaaaattacatggggagattcgcatcaccct
gctttgactgaaaaaaatggtgaatacgttggtgattaccttttcattaatgataaagcc
aaccccagaattgctgttattgatctgaaagattttgaaacagttcagattgtaacaaac
ccaataatgaaaagtgaacacggaggtgcctttgtcacccctaacagtgaatacattatt
gaggcaacacaatatgcagcacctcttgatgaccaatggcatcctatagaggactacgaa
aattcgtttcgtggtgctctgactatgtggaagtttgattatgacaagggcagaattaat
actgataaatctttttcactggaacttcctccttacatgcaggatctttcagatgcaggt
aagggcgtttccaacggatggggttttataaactcttttaactcagaaatgtatactggc
gggattgaaaaaggtcttcctccttttgaagcaggtatgagccgtaatgacaatgactac
cttcatattttcaattggaaaatccttgaaaaacttgccgaggacgagaaaaactataag
atctacaacggtcatagagttatttctatggaggctgctatcaaagcaggcgctcttttc
cttatcccggaaccgaagtctcctcatggtgtagacgtctctcctgacggaagatttctg
attgtatgcggcaagcttgatactcatgcttctgtttatgatttcaataaaatcaaaggt
ttgattgataaaaaagaatttattggtaaagacccttacggtatacctattctggacatg
aagaaaacacttcatggtcaggttgagcttgggctcgggcctttgcatagttcttttgtg
cctgaggaaggtgttctttatacctctctttacgttgattctcagattgtcaaatgggat
tataagaatcttaaagttctcgacagaatcaatgttcactacaacataggtcacgttgat
gctatggaaggtaaatcagctaaacctgctggtaaatatgtgattgcacttaataagcta
tccatcgacaggtttaatcccgtgggaccccttcaccctcagaaccatcagcttattgat
ataacaggtccgaaaatggaactgctatacgatatgcctattcctcttggtgaaccccat
gatgttgtgactatagccgcatcaaaacttaagcctaaaaaaacatatgatatgggtagc
gactcgcgtactggtaaaccgcaccctgacgcaactcttgccggcagcgaacggattgag
agaaacggtaaaaatgtaaaagtttatgcgaccatggttcgttcacacataaaccctgag
catattactgtcaacaaaggtgatgttgttacaatcgttgtgacaaaccttgagagagca
caggacgaaacacacggtttcggtgttgacggtatgaacgttcacgcttcagttgagccg
ggcaaaacggcaagtgtaacttttgtggcagatcaggaaggtgtattcccatattactgt
acagagttctgctctgctctacaccttgagatgatgggatatcttttcgtcaaagatcct
gacaaaaagtacgaagatatcaaaaaaactcagcttaaaaagatgagccaggaagagctc
atggctgaatataaaaagataatagccacaaataaagcgactgatgatgtcatccagtct
gtagttaagtatctgaaagataataactatcagaaatattccagcattgaaaggcttgta
gttgacgcccttgatcaatacggcaagattcctgaggtaaaagcgaaagcagatgatgcc
tataataaaggcaatctggatgaagctatcctgtgggaaaaccaggtatggcagtacatg
gttaaaaccgccgatgtcggactgcgcgccaaaaataaccttgcgagaacgattgccact
ccgatgagtgatgcagcagcaagaggcgagcttgcatatcttgaaggcgggtgtaacggc
tgtcatgttatcggtcaggtcagctccggtcccgacctcacaggttcaatctggcgtacg
aacgaaaaatgggtttgggaattcatcaaagatccggcaccgaaatataacgaaccttac
gttaaggaatacatcgattacttcaatctcagaatgccgaaccagaatatgtccgacaaa
gaggtggatgatatagtggagtatatgaagtggattgatgaaaacgccgatttgttctaa

DBGET integrated database retrieval system