KEGG   Denitrovibrio acetiphilus: Dacet_0941Help
Entry
Dacet_0941        CDS       T01189                                 

Definition
(GenBank) Nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00910  Nitrogen metabolism
dap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Dacet_0941
Enzymes [BR:dap01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Dacet_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cupredoxin_1 COX2 Cytochrome_CBB3 Lactonase HEXIM NHL
Motif
Other DBs
NCBI-ProteinID: ADD67719
UniProt: D4H673
Position
985303..987882
Genome map
AA seq 859 aa AA seqDB search
MSKVRNVFLLFSLFVFVTGASASTLQDIMKQRNLSEKDILAAAKTYQPSGRKDEFITFSS
GGQSGQVIVYGVPSMRIYKYIGVFTPEPWQGYGYDNESKKVLEGGNFRGKKITWGDSHHP
ALTEKNGEYVGDYLFINDKANPRIAVIDLKDFETVQIVTNPIMKSEHGGAFVTPNSEYII
EATQYAAPLDDQWHPIEDYENSFRGALTMWKFDYDKGRINTDKSFSLELPPYMQDLSDAG
KGVSNGWGFINSFNSEMYTGGIEKGLPPFEAGMSRNDNDYLHIFNWKILEKLAEDEKNYK
IYNGHRVISMEAAIKAGALFLIPEPKSPHGVDVSPDGRFLIVCGKLDTHASVYDFNKIKG
LIDKKEFIGKDPYGIPILDMKKTLHGQVELGLGPLHSSFVPEEGVLYTSLYVDSQIVKWD
YKNLKVLDRINVHYNIGHVDAMEGKSAKPAGKYVIALNKLSIDRFNPVGPLHPQNHQLID
ITGPKMELLYDMPIPLGEPHDVVTIAASKLKPKKTYDMGSDSRTGKPHPDATLAGSERIE
RNGKNVKVYATMVRSHINPEHITVNKGDVVTIVVTNLERAQDETHGFGVDGMNVHASVEP
GKTASVTFVADQEGVFPYYCTEFCSALHLEMMGYLFVKDPDKKYEDIKKTQLKKMSQEEL
MAEYKKIIATNKATDDVIQSVVKYLKDNNYQKYSSIERLVVDALDQYGKIPEVKAKADDA
YNKGNLDEAILWENQVWQYMVKTADVGLRAKNNLARTIATPMSDAAARGELAYLEGGCNG
CHVIGQVSSGPDLTGSIWRTNEKWVWEFIKDPAPKYNEPYVKEYIDYFNLRMPNQNMSDK
EVDDIVEYMKWIDENADLF
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagttaggaatgtatttttgctgttttctctttttgtctttgtgacaggtgct
tcagccagcacattgcaggatattatgaaacagcgcaacctgtcagaaaaggatattctg
gcagcagcaaaaacttatcaaccttctggtagaaaagacgaatttattaccttttcttcc
ggtggtcaatcaggtcaggttatagtttatggtgttccctctatgaggatttacaagtac
ataggagtatttacacctgaaccgtggcagggttacggctatgataatgaatccaaaaaa
gttttagaaggtggcaatttcagagggaagaaaattacatggggagattcgcatcaccct
gctttgactgaaaaaaatggtgaatacgttggtgattaccttttcattaatgataaagcc
aaccccagaattgctgttattgatctgaaagattttgaaacagttcagattgtaacaaac
ccaataatgaaaagtgaacacggaggtgcctttgtcacccctaacagtgaatacattatt
gaggcaacacaatatgcagcacctcttgatgaccaatggcatcctatagaggactacgaa
aattcgtttcgtggtgctctgactatgtggaagtttgattatgacaagggcagaattaat
actgataaatctttttcactggaacttcctccttacatgcaggatctttcagatgcaggt
aagggcgtttccaacggatggggttttataaactcttttaactcagaaatgtatactggc
gggattgaaaaaggtcttcctccttttgaagcaggtatgagccgtaatgacaatgactac
cttcatattttcaattggaaaatccttgaaaaacttgccgaggacgagaaaaactataag
atctacaacggtcatagagttatttctatggaggctgctatcaaagcaggcgctcttttc
cttatcccggaaccgaagtctcctcatggtgtagacgtctctcctgacggaagatttctg
attgtatgcggcaagcttgatactcatgcttctgtttatgatttcaataaaatcaaaggt
ttgattgataaaaaagaatttattggtaaagacccttacggtatacctattctggacatg
aagaaaacacttcatggtcaggttgagcttgggctcgggcctttgcatagttcttttgtg
cctgaggaaggtgttctttatacctctctttacgttgattctcagattgtcaaatgggat
tataagaatcttaaagttctcgacagaatcaatgttcactacaacataggtcacgttgat
gctatggaaggtaaatcagctaaacctgctggtaaatatgtgattgcacttaataagcta
tccatcgacaggtttaatcccgtgggaccccttcaccctcagaaccatcagcttattgat
ataacaggtccgaaaatggaactgctatacgatatgcctattcctcttggtgaaccccat
gatgttgtgactatagccgcatcaaaacttaagcctaaaaaaacatatgatatgggtagc
gactcgcgtactggtaaaccgcaccctgacgcaactcttgccggcagcgaacggattgag
agaaacggtaaaaatgtaaaagtttatgcgaccatggttcgttcacacataaaccctgag
catattactgtcaacaaaggtgatgttgttacaatcgttgtgacaaaccttgagagagca
caggacgaaacacacggtttcggtgttgacggtatgaacgttcacgcttcagttgagccg
ggcaaaacggcaagtgtaacttttgtggcagatcaggaaggtgtattcccatattactgt
acagagttctgctctgctctacaccttgagatgatgggatatcttttcgtcaaagatcct
gacaaaaagtacgaagatatcaaaaaaactcagcttaaaaagatgagccaggaagagctc
atggctgaatataaaaagataatagccacaaataaagcgactgatgatgtcatccagtct
gtagttaagtatctgaaagataataactatcagaaatattccagcattgaaaggcttgta
gttgacgcccttgatcaatacggcaagattcctgaggtaaaagcgaaagcagatgatgcc
tataataaaggcaatctggatgaagctatcctgtgggaaaaccaggtatggcagtacatg
gttaaaaccgccgatgtcggactgcgcgccaaaaataaccttgcgagaacgattgccact
ccgatgagtgatgcagcagcaagaggcgagcttgcatatcttgaaggcgggtgtaacggc
tgtcatgttatcggtcaggtcagctccggtcccgacctcacaggttcaatctggcgtacg
aacgaaaaatgggtttgggaattcatcaaagatccggcaccgaaatataacgaaccttac
gttaaggaatacatcgattacttcaatctcagaatgccgaaccagaatatgtccgacaaa
gaggtggatgatatagtggagtatatgaagtggattgatgaaaacgccgatttgttctaa

DBGET integrated database retrieval system