KEGG   Denitrovibrio acetiphilus: Dacet_1153Help
Entry
Dacet_1153        CDS       T01189                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dacet_1153
   01230 Biosynthesis of amino acids
    Dacet_1153
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dacet_1153
   00030 Pentose phosphate pathway
    Dacet_1153
   00051 Fructose and mannose metabolism
    Dacet_1153
   00052 Galactose metabolism
    Dacet_1153
  Energy metabolism
   00680 Methane metabolism
    Dacet_1153
Enzymes [BR:dap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dacet_1153
Protein phosphatases and associated proteins [BR:dap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dacet_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199476..1200438
Genome map
AA seq 320 aa AA seqDB search
MKKIAVMTSGGDSPGMNAGIRSVVRTGLANDIEVYGIEQGFKGLIEGQIRKLNSRDVSNT
IQRGGTFLRSARCMEFKTEAGQKKALDNLESFGIEGLIVIGGDGSLTGAKILYEKYGVKV
VGMPGSIDNDIYGTSISIGVDTALNNIARAVDMINETASSHDRTFIIEVMGRHCGYLALM
SAIACGAEAVIIPEIEYNLENIIDKIKQRYVEGKSRSVVIVAEGAGSAVDFGKAFQLIGG
FDTRITVLGHLQRGGSPTVFDRTLATRMGAAAVDGLLAGHGGVMTALAGREISLIDLDVV
LSNKRELDTKFMEIAEDLSL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagcagttatgacaagcggtggtgacagcccggggatgaacgcaggtatc
agaagtgttgtccgcacagggcttgcgaatgatatcgaagtatatgggattgaacagggg
ttcaaagggctgatagaagggcagattcgtaagctcaacagccgggatgtttcaaatact
atccagcgtggcggaacatttctccgcagtgccagatgtatggaattcaaaacagaagca
ggtcagaagaaggctctggataatcttgaatcattcggtatagaaggtttgattgtcata
ggcggtgacggttctctgacaggagctaaaattctgtatgaaaaatatggtgtaaaggtt
gtcggtatgcccggatccattgataatgatatttacggaacaagtatatctataggtgtt
gacactgctcttaataatattgcaagagctgtggacatgatcaacgaaacagccagctcg
cacgacagaactttcattatcgaagttatggggcggcactgcggatatctggcgcttatg
tctgctatagcctgcggggcggaagctgttatcattcctgaaatagaatacaaccttgaa
aatataatagataagataaagcagaggtatgttgaaggtaaatccagaagtgttgtcatt
gttgcagagggtgccggaagtgctgtggattttggcaaagcatttcagcttatcggcggt
tttgatacacgaattaccgttcttggtcaccttcagagaggggggagcccgactgttttc
gacaggacactcgccacaagaatgggagcagcggctgttgacggacttcttgccggacat
ggcggtgttatgacagctcttgccggacgcgaaatatcacttattgatcttgatgtagtt
ctgtctaacaagcgtgagctcgacactaaatttatggagattgccgaggatctcagcctc
tga

DBGET integrated database retrieval system