KEGG   Denitrovibrio acetiphilus: Dacet_1153Help
Entry
Dacet_1153        CDS       T01189                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00010  Glycolysis / Gluconeogenesis
dap00030  Pentose phosphate pathway
dap00051  Fructose and mannose metabolism
dap00052  Galactose metabolism
dap00680  Methane metabolism
dap01100  Metabolic pathways
dap01110  Biosynthesis of secondary metabolites
dap01120  Microbial metabolism in diverse environments
dap01130  Biosynthesis of antibiotics
dap01200  Carbon metabolism
dap01230  Biosynthesis of amino acids
dap03018  RNA degradation
Module
dap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dacet_1153
   00030 Pentose phosphate pathway
    Dacet_1153
   00051 Fructose and mannose metabolism
    Dacet_1153
   00052 Galactose metabolism
    Dacet_1153
  Energy metabolism
   00680 Methane metabolism
    Dacet_1153
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dacet_1153
Enzymes [BR:dap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dacet_1153
Protein phosphatases and associated proteins [BR:dap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dacet_1153
Messenger RNA biogenesis [BR:dap03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dacet_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADD67925
UniProt: D4H7C6
Position
1199476..1200438
Genome map
AA seq 320 aa AA seqDB search
MKKIAVMTSGGDSPGMNAGIRSVVRTGLANDIEVYGIEQGFKGLIEGQIRKLNSRDVSNT
IQRGGTFLRSARCMEFKTEAGQKKALDNLESFGIEGLIVIGGDGSLTGAKILYEKYGVKV
VGMPGSIDNDIYGTSISIGVDTALNNIARAVDMINETASSHDRTFIIEVMGRHCGYLALM
SAIACGAEAVIIPEIEYNLENIIDKIKQRYVEGKSRSVVIVAEGAGSAVDFGKAFQLIGG
FDTRITVLGHLQRGGSPTVFDRTLATRMGAAAVDGLLAGHGGVMTALAGREISLIDLDVV
LSNKRELDTKFMEIAEDLSL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagcagttatgacaagcggtggtgacagcccggggatgaacgcaggtatc
agaagtgttgtccgcacagggcttgcgaatgatatcgaagtatatgggattgaacagggg
ttcaaagggctgatagaagggcagattcgtaagctcaacagccgggatgtttcaaatact
atccagcgtggcggaacatttctccgcagtgccagatgtatggaattcaaaacagaagca
ggtcagaagaaggctctggataatcttgaatcattcggtatagaaggtttgattgtcata
ggcggtgacggttctctgacaggagctaaaattctgtatgaaaaatatggtgtaaaggtt
gtcggtatgcccggatccattgataatgatatttacggaacaagtatatctataggtgtt
gacactgctcttaataatattgcaagagctgtggacatgatcaacgaaacagccagctcg
cacgacagaactttcattatcgaagttatggggcggcactgcggatatctggcgcttatg
tctgctatagcctgcggggcggaagctgttatcattcctgaaatagaatacaaccttgaa
aatataatagataagataaagcagaggtatgttgaaggtaaatccagaagtgttgtcatt
gttgcagagggtgccggaagtgctgtggattttggcaaagcatttcagcttatcggcggt
tttgatacacgaattaccgttcttggtcaccttcagagaggggggagcccgactgttttc
gacaggacactcgccacaagaatgggagcagcggctgttgacggacttcttgccggacat
ggcggtgttatgacagctcttgccggacgcgaaatatcacttattgatcttgatgtagtt
ctgtctaacaagcgtgagctcgacactaaatttatggagattgccgaggatctcagcctc
tga

DBGET integrated database retrieval system