KEGG   Denitrovibrio acetiphilus: Dacet_1177Help
Entry
Dacet_1177        CDS       T01189                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dacet_1177
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dacet_1177
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dacet_1177
Enzymes [BR:dap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dacet_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1226317..1227480
Genome map
AA seq 387 aa AA seqDB search
MYDKMFYGRYGGQFVPETLIPAIDDLEAKFEELKDDAKFNEELKELFTKYAGRPTPVYKA
QNLSDKYGCEIYLKREDLMHTGAHKLNNTLGQALLTKYMGKKRIIAETGAGQHGVATATV
AALFGMECTVYMGALDVKRQEPNVKRMELLGAEVVAVTEGQGALKEATNAALREWVASVE
TTHYIIGSIVGPYPFPKIVAHFQSVIGQEANVQCRDMGFTPDCVVACVGGGSNAIGIFNG
FLDKQCELYGVEAGGVSDEDCKHARTLGKGKPGVLHGSYTYLVQTPEHQISDVHSISAGL
DYPGIGPVHAMLHDVGRVKYGYVRDDEALNAFKELSRNEGIIPALESSHALAYVIENKEK
FKGKKVLVNLSGRGDKDMAAILERGLI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtacgataaaatgttttatggaagatacggagggcagtttgtaccggaaacacttatt
ccggctatagacgaccttgaggcgaagttcgaagagctgaaggatgatgcgaaattcaat
gaagagctgaaagaactttttactaagtatgccggaagaccaactcctgtttataaggct
cagaatctctctgataagtacggatgcgaaatatacctgaagcgtgaagacctcatgcat
acgggtgcacataagctcaacaacactcttgggcaggcactccttacaaaatatatgggg
aagaaacgtatcatagctgaaactggtgcggggcagcatggtgtagcgactgcaactgtg
gctgcgcttttcggcatggaatgcacagtttatatgggggctctggatgtaaagaggcag
gagcctaatgttaagcgtatggagcttctcggtgcggaagttgtagctgtaacagaaggg
cagggggcgctgaaagaagcgactaatgcggctctgcgtgagtgggtggcaagtgtggaa
acaacacattatatcataggttcgatcgtgggaccttatccattcccgaaaattgtggca
catttccagtctgtcataggacaggaggcaaacgtacagtgcagagatatggggtttact
cctgactgtgttgttgcctgtgtcggcggtgggagtaatgctatcggtatatttaacgga
tttttagacaagcagtgcgagctgtacggtgtcgaggctggcggtgtttctgatgaagac
tgcaaacacgccagaactctcggtaaaggtaaacctggggttcttcatggttcatataca
taccttgtgcagacgcccgaacatcagatatctgatgtccattcaatttctgccgggctg
gattaccccgggataggtcctgtccatgctatgttgcacgacgtcggcagggtaaaatac
ggatatgtcagagacgatgaggcacttaacgcatttaaagagctatccagaaacgaaggg
ataatccctgctcttgagtcaagtcacgctctggcatacgttattgaaaacaaagagaag
ttcaagggtaaaaaggtgcttgtcaacctctctggcagaggagacaaagacatggcggct
atacttgaaagggggctgatatga

DBGET integrated database retrieval system