KEGG   Denitrovibrio acetiphilus: Dacet_1297Help
Entry
Dacet_1297        CDS       T01189                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dap00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349153..1350013
Genome map
AA seq 286 aa AA seqDB search
MYIAGDTILTSRVKSFSLKRPLLMGILNITPDSFSDGGMFNHVDGMISRIEEFVSKGVDI
ADIGGESTRPGSEFINADEEINRVVPAVKLASESGLYVSVDTNKPEVAKAVLESGAGMIN
DITGMRDEHMRKICAEYKCSVCIMHMQGAPKDMQANPVYVDVVEDVRRYLFEAAEQCIKD
GIEESAICLDPGFGFGKSVEDNYRLLMKLERFKESGFPVLAGISRKSMIGNVIGRPPVQR
LAGTITAETIALIKGADIIRAHDIDETADMISVYMKAKEAGERCSN
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgtatatagcgggggacaccattttaacttcaagagtgaaatcattttcgcttaaacga
cctcttttgatggggatattaaacatcactcctgattctttcagtgacggtgggatgttt
aaccatgttgacggtatgatatcccgtatagaggaatttgtgtccaaaggtgttgatatc
gccgacataggtggtgaatctaccagacccggttcggaatttataaatgcagatgaagag
ataaacagggttgtccctgctgttaagctcgcttcagaaagtggtctctatgtttctgtg
gataccaacaaaccggaagttgcgaaagcagttcttgaaagcggtgcaggtatgattaac
gacatcacggggatgcgtgatgaacatatgcggaaaatatgtgctgagtataaatgcagc
gtatgtataatgcatatgcagggggcgccgaaagatatgcaggcgaatccggtatatgtt
gatgttgttgaagatgtccgcagataccttttcgaagcagcggaacaatgcataaaggat
ggtatagaagaaagtgctatatgccttgacccggggtttggtttcggaaagagtgtagag
gataattacaggctgctgatgaagctggagagatttaaggagagcggatttcctgttctc
gccggcatatccagaaaatctatgataggcaatgtcataggcagacctcctgtccagagg
cttgcgggtactatcacagcagaaacaattgcacttataaaaggtgcagatataatcagg
gcacatgatatcgacgaaactgccgatatgataagcgtatacatgaaagcaaaagaggca
ggtgagagatgctcgaactga

DBGET integrated database retrieval system