KEGG   Denitrovibrio acetiphilus: Dacet_1412Help
Entry
Dacet_1412        CDS       T01189                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dacet_1412
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dacet_1412
Enzymes [BR:dap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dacet_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1462344..1463288
Genome map
AA seq 314 aa AA seqDB search
MSYNRKDLLGMSDLSAEEITYLLDTAQTFCEINERDVKKVPTLKGRTVINVFFEPSTRTR
TSFEIAGKRLSADTINFTASSSSTTKGETLIDTVKNMEAMHSDVFVVRHSYSGAVKLIAE
NTDTAVVNAGDGLNEHPTQALLDLLTIRQRKGKIKGLEIAIIGDITHSRVARSDIWAMNK
LGANVRVYGPLTMLPKYIAPFNCRKCTSMEEALEGADVIIMLRIQHERQGKLLLPSTREY
AKFFGLTNEKLEIADKDAIVMHPGPINRGVELMTNVADCNRAVVLDQVSNGVAVRMAALY
LLGNRKGGKIENAS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacaatagaaaagatcttttgggaatgtccgacctgagcgcggaggagataact
tatcttctggacactgcccagacattttgcgagattaacgaacgggatgtaaaaaaagtt
ccgacacttaaaggaaggactgtgatcaatgttttttttgagccgtctacaagaaccaga
acatcctttgagattgcaggaaagagactttcagccgacaccattaactttacagcctcc
tcaagcagtacaacaaaaggggaaaccctcatcgatactgtaaaaaatatggaggcgatg
cattctgatgttttcgttgtgcgccacagctactccggtgcagtaaaactcatagctgaa
aatactgacacagcagttgttaacgccggagatggtctgaatgagcaccctacacaggca
ttgcttgacctgctgacaatcaggcagcgtaaaggaaagataaagggacttgaaatagcc
atcataggcgacattacgcattcaagggtggcaagatcggatatatgggcgatgaataag
cttggcgcaaatgtccgcgtttacggccccctcaccatgcttcctaaatacatagcaccg
ttcaactgccgtaaatgtaccagcatggaagaagcactggaaggagctgacgttataatt
atgctccgcatccagcatgaaagacagggtaagcttctcctgccgtccacaagggaatat
gccaaattcttcgggctgactaacgagaagctggagatagccgacaaagacgcaatcgtt
atgcaccccggccctatcaacagaggggttgaacttatgactaatgttgcagactgtaac
agggctgttgtccttgatcaggtttctaacggtgttgccgttcgcatggcagctctctat
ctactcggaaacagaaaagggggaaaaattgaaaacgcttcttaa

DBGET integrated database retrieval system