KEGG   Denitrovibrio acetiphilus: Dacet_1518Help
Entry
Dacet_1518        CDS       T01189                                 

Definition
Esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dap  Denitrovibrio acetiphilus
Brite
Enzymes [BR:dap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dacet_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1578384..1579307)
Genome map
AA seq 307 aa AA seqDB search
MRKYAWLIILIIFTVIYMFSGRPQYELMPFIDLSEVDDGELSDLDFKKAESEDVRLPENY
PQFYKGGDVGVLIVHGFTGSPLEMQPLADYLQKAGFSTYQVRVAGHGSEPANLNLTTYED
WYESARYGYFILRRNCKKVYILGESMGGLVALSVAAYNDTDGTILLSPCIKMKNSAVNLS
PFLRHFVKIIPKVEAGDWKKELRHIYYDKWPVEGIYQLLMYTKYISTHMEKMDFPMLGFQ
FMNDAVVSGKATKEFFENAPAEDKKLIIFPNKKMKNHILVSEKNVYREEMFTTIAEWLNE
RGANDVK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtatgcgtggctgataatactaattatatttacggtgatttacatgttttcc
ggaagaccacaatatgaacttatgccttttattgacctgagcgaagttgatgacggagaa
ctttccgaccttgattttaaaaaagcagaatcggaggatgtccggctgcccgaaaactac
ccacagttttataaaggcggagatgtaggtgtactcattgttcatggctttacagggtcg
cctctggagatgcagcctttagctgattatcttcagaaagccggtttttcaacttatcag
gttcgtgttgctgggcatggttcagaaccggcaaacctgaacctcaccacatatgaggac
tggtacgaatctgcaagatacggatattttatattaagaagaaactgtaaaaaagtttat
attcttggtgaatcaatgggcggactggtagctctgagtgttgctgcatataacgatact
gacggaactatactcctgtcgccatgcataaaaatgaaaaattccgctgttaacctcagc
ccgtttctcagacattttgtcaaaataatcccaaaggttgaagcgggtgactggaagaaa
gaattaagacatatatactatgacaagtggcctgttgaagggatctatcagcttcttatg
tatacaaaatatatcagtacccatatggaaaagatggattttccaatgctcgggtttcag
ttcatgaacgatgctgtagtcagtggaaaagcaaccaaagagttctttgaaaatgctcct
gccgaagacaaaaaacttattattttccccaataaaaagatgaaaaaccatatacttgtg
tctgaaaaaaatgtttacagagaagaaatgtttactacaatagctgagtggctgaatgaa
agaggagcaaatgatgttaagtaa

DBGET integrated database retrieval system