KEGG   Denitrovibrio acetiphilus: Dacet_1839Help
Entry
Dacet_1839        CDS       T01189                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dacet_1839
   00052 Galactose metabolism
    Dacet_1839
   00500 Starch and sucrose metabolism
    Dacet_1839
   00520 Amino sugar and nucleotide sugar metabolism
    Dacet_1839
Enzymes [BR:dap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dacet_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1940355..1941224)
Genome map
AA seq 289 aa AA seqDB search
MKVRTAVFPVAGLGTRLLPATKSMPKEMVTLIDRPLIQYAVEEVIDAGVERVVFVSARSK
KALEDHFDRTPELEYQLEEAGKEDVLKDVQKLSSMCDIIYIRQKEPLGLGHAVLCAKDIV
GKEPFAVILPDDIISSKEPVTGQLIKRYTQTGKSVVSLMEVPDEDTSKYGIVKLGREEDK
GLFKLDGMVEKPKSNPPSNMAIIGRYILTPEVMAALETTKRGAGGEIQLTDAILDVAKSE
GVYGYLFEGDRFDCGNMYGLFEAVVNFALERKDLREHAVKVIQEAAKRF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaacagcagtttttcctgtagcaggtcttggaacaaggcttcttcctgca
acaaagtctatgcctaaggagatggtcacgctcatcgacagaccactgatccagtatgct
gttgaagaggttatagatgcaggtgtcgaaagggttgtttttgtctcggctagaagcaaa
aaggctctggaagatcactttgacagaactcctgagttggaataccaacttgaggaagcg
ggcaaagaagatgtgctgaaggatgtgcagaagctttcgtcaatgtgcgatataatatat
atacgtcagaaagagcctttgggactggggcatgcggtgctctgcgcaaaggatatagta
gggaaagaaccctttgcggttattctgccggatgacataataagcagcaaagaacctgtt
accggtcagctcattaaaagatatacccagacgggaaagtcagttgtgtcactcatggaa
gtacccgacgaagatacttctaagtatggcatagtaaagctgggcagagaagaggataag
gggctgtttaagcttgatggtatggtggaaaagcctaaaagcaatccaccgtcaaatatg
gctattataggcaggtatattcttacccctgaagttatggcggctcttgaaactacaaaa
aggggcgcaggcggtgagatacagcttacagacgctatacttgatgttgcaaagtcagaa
ggtgtttacggatatcttttcgaaggggacagatttgactgtggcaacatgtacggactt
tttgaagcggttgtgaattttgctctggagagaaaagacctcagagaacacgctgtcaaa
gtgattcaggaagcggcaaaacgtttctaa

DBGET integrated database retrieval system