KEGG   Denitrovibrio acetiphilus: Dacet_1839Help
Entry
Dacet_1839        CDS       T01189                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dacet_1839
   00052 Galactose metabolism
    Dacet_1839
   00500 Starch and sucrose metabolism
    Dacet_1839
   00520 Amino sugar and nucleotide sugar metabolism
    Dacet_1839
Enzymes [BR:dap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dacet_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1940355..1941224)
Genome map
AA seq 289 aa AA seqDB search
MKVRTAVFPVAGLGTRLLPATKSMPKEMVTLIDRPLIQYAVEEVIDAGVERVVFVSARSK
KALEDHFDRTPELEYQLEEAGKEDVLKDVQKLSSMCDIIYIRQKEPLGLGHAVLCAKDIV
GKEPFAVILPDDIISSKEPVTGQLIKRYTQTGKSVVSLMEVPDEDTSKYGIVKLGREEDK
GLFKLDGMVEKPKSNPPSNMAIIGRYILTPEVMAALETTKRGAGGEIQLTDAILDVAKSE
GVYGYLFEGDRFDCGNMYGLFEAVVNFALERKDLREHAVKVIQEAAKRF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaacagcagtttttcctgtagcaggtcttggaacaaggcttcttcctgca
acaaagtctatgcctaaggagatggtcacgctcatcgacagaccactgatccagtatgct
gttgaagaggttatagatgcaggtgtcgaaagggttgtttttgtctcggctagaagcaaa
aaggctctggaagatcactttgacagaactcctgagttggaataccaacttgaggaagcg
ggcaaagaagatgtgctgaaggatgtgcagaagctttcgtcaatgtgcgatataatatat
atacgtcagaaagagcctttgggactggggcatgcggtgctctgcgcaaaggatatagta
gggaaagaaccctttgcggttattctgccggatgacataataagcagcaaagaacctgtt
accggtcagctcattaaaagatatacccagacgggaaagtcagttgtgtcactcatggaa
gtacccgacgaagatacttctaagtatggcatagtaaagctgggcagagaagaggataag
gggctgtttaagcttgatggtatggtggaaaagcctaaaagcaatccaccgtcaaatatg
gctattataggcaggtatattcttacccctgaagttatggcggctcttgaaactacaaaa
aggggcgcaggcggtgagatacagcttacagacgctatacttgatgttgcaaagtcagaa
ggtgtttacggatatcttttcgaaggggacagatttgactgtggcaacatgtacggactt
tttgaagcggttgtgaattttgctctggagagaaaagacctcagagaacacgctgtcaaa
gtgattcaggaagcggcaaaacgtttctaa

DBGET integrated database retrieval system