KEGG   Denitrovibrio acetiphilus: Dacet_1888Help
Entry
Dacet_1888        CDS       T01189                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dap01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dap00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1990403..1991545)
Genome map
AA seq 380 aa AA seqDB search
MRKLPKIETLVVKVGSNILTHHERGVNLEFLSGLVRILCNFKKNIPNIVVVSSGAVGAGF
KLLGFSERPQNITDKQACAAVGQARLIWEYDREFEKYGVTSAQILITKDDLSNRRRYLNA
RYTLRRLLELGVVPVINENDSVVIEELRQIENFTDNDNLSALVSGLIGADMLLILSDVDG
LFDKDPFKNKDAKRIEEVKYINEELLNVAGDSVSGVGTGGMKSKLEAAGKALDAGCHVGI
INGMNLFNVEAFLNGEDVGTFFNHIEDPLTRRKHWIAYAAGASGELHVDNGAVNALVNKK
TSLLPSGVTKVTGHFGMGDVVAVIGPDGKEVARGKVRYASEDADLIKGKKSSDISSILGY
KFTDEIIHRDDLVVTTNNGA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaacttcctaaaattgaaacacttgtagttaaggtcggaagcaatatcctcact
catcacgagcgtggtgtaaatcttgagtttctttccggtctggttcgcatcctctgtaat
ttcaaaaagaatattccgaacattgttgttgtgtcttccggtgctgtgggggcagggttt
aagctgctcggttttagcgaacgtccgcagaacatcactgataaacaggcctgtgctgct
gtcggacaggcgagattgatatgggaatacgacagagagtttgaaaaatatggcgtgaca
tcggcgcagatacttatcacaaaggatgacctttcaaacagaaggcgttacctgaatgct
agatacacattgcggcggctgcttgagctgggggttgtgcctgttataaatgaaaatgat
tcagttgttatagaagagcttcgtcagatagaaaacttcacagacaatgacaacctttct
gctttggttagcggacttataggggcagacatgcttcttatattgtctgatgttgatggg
ctttttgataaagatccttttaagaataaagatgcaaaacgcattgaagaagtgaaatat
atcaacgaggaacttctgaacgtagcgggggattccgtttccggagttggtaccggaggt
atgaagtccaagctggaagccgcaggaaaggcgcttgacgcaggatgtcatgtaggcatt
ataaacggcatgaacctttttaatgttgaggcgtttctgaatggtgaggatgtcgggaca
ttttttaaccacatagaagaccctctgaccagacgcaagcactggatagcttacgcagca
ggagcaagcggagagctgcatgttgataacggagctgttaacgcactggtgaataaaaaa
acctctcttctgcccagcggagtgacgaaagttaccgggcatttcggcatgggggatgtt
gtcgcggttatcggtcctgacggaaaagaagtcgccagaggcaaagtccgctatgcatcc
gaagatgctgacctgataaaaggtaaaaaatcttctgacatatcttctattttagggtat
aagtttactgatgagataattcacagggatgaccttgttgtaacaacgaacaacggagct
tga

DBGET integrated database retrieval system