KEGG   Denitrovibrio acetiphilus: Dacet_1964Help
Entry
Dacet_1964        CDS       T01189                                 

Definition
phenylalanyl-tRNA synthetase subunit beta
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dap00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dacet_1964
Enzymes [BR:dap01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     Dacet_1964
Amino acid related enzymes [BR:dap01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   Dacet_1964
Transfer RNA biogenesis [BR:dap03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Dacet_1964
 Prokaryotic Type
    Dacet_1964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2067602..2069971
Genome map
AA seq 789 aa AA seqDB search
MKVSLNWLNKFVEVADLDPNDIAEKLTMCGLEVDAVEHLAPLDNVVVAKVKSCVKHPDAD
KLSLCEVFDGTETYQVVCGAPNVAEGQTIVFAKIGAVLPGNFKIKKAKIRGTESSGMICA
EDEIGLSENHDGIMVLDDSLEPGMPVNELFGLPDTVLEIGITPNRADCLSIIGYAHEIAA
LYNRKLKKNEYKLNETDEPAGNYGGVEIKNKKACPTYLGRVIKDVTIKPSPLWMQNRLRA
VGVRPISNVVDITNYVLFEYGQPLHTFDLKEIDGRIIIRNAENGEKLITLDEKERVFNEN
MLLITDEKKSLAIAGVMGGEHSGISKDTKDVFLECAYFEPKQTRMTARKLGMQTDASYRY
ERGIDPVNTKEMCEYAAYLIQELCGGKVCKGVLGEVNDPEPITFTVNADWINSYLGTDVS
LDQMVQILDGLNMNPVVNSRDITITSPSYRVDIITRQDIAEEIARMYGYNNIPTTLPKID
ADSMPMQPLLATRRFLAQKLKTLGFNEAINYSFMKADFLKLFDSEEKFVKLINPISEDMN
TMRTQVFPGLLATIRYNLNNGFKQARFFEFASSFIKTEDKLPEQRMLLAAASAGDFWDVS
WAAPKGTEPFFMMKGVLENLLAQYKIKAEFTKSSRHFLHPGKSAEVIVNGKSIGFIGELH
PLTAEAAELRERVTFFEIDMQDFVDNAEFVFKFESFSKFPSVYKDISVIVDTDTPTEKLT
ECIKNTSKLAEDVSLYDVYTGKGIEEGKASRTFRVLFTAGDRTLTDEETNGILQKMIDNL
VKDYGAQLR
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagtttaaactggttaaataaatttgtagaagtagccgaccttgaccctaat
gatatagctgagaagctcaccatgtgcggtctggaagttgatgctgttgaacacctcgcc
cccctcgacaatgtggttgttgcgaaggtcaaatcatgtgtaaagcatccggatgccgac
aagctttctctctgcgaagtcttcgacggaacagaaacttatcaggttgtatgcggtgca
ccaaatgttgcagaaggtcagacaatagtatttgcaaagataggcgctgtcctgccgggt
aatttcaaaatcaaaaaagccaaaatcagaggaacagaatcttcgggtatgatatgtgca
gaagatgagatcggactttcagaaaatcatgacggaataatggttctggatgactctctc
gaaccgggaatgcccgtaaacgagcttttcggactgccggatactgtactggaaataggt
atcacacctaaccgcgcagattgcctgagcatcataggctatgcccatgagattgcagcc
ctctataaccgtaaactcaaaaaaaatgagtacaaactaaacgaaacagacgagcctgcc
ggtaattacggcggtgttgaaataaaaaataaaaaagcgtgccctacttatctggggcgt
gtcatcaaagatgtaactatcaaaccatctccgctctggatgcagaacagactgcgtgcc
gtgggggtacgtcccatcagcaacgttgtagacattacaaactatgtgctgttcgagtac
ggccagcctctgcacactttcgacctgaaagagatagatggcaggatcatcatccgtaac
gctgaaaatggtgaaaaattgattacgcttgatgagaaagaacgtgtattcaacgaaaac
atgctccttatcacagacgaaaaaaaatctcttgcgatagctggtgttatgggtggagaa
cactcagggatcagcaaagacacaaaagatgtctttcttgagtgtgcatacttcgagccg
aaacagacacgcatgacagcaagaaaactcggcatgcagacagatgcttcatatcgctac
gaaaggggcattgacccggttaacacaaaagagatgtgcgaatacgcagcatatcttatt
caggagctatgcggagggaaagtatgcaaaggcgttctgggtgaggttaacgaccccgag
ccaataacattcactgtaaatgcagactggattaacagctacctggggacagacgtctcc
cttgaccagatggtgcagatactggatggtctgaacatgaaccctgttgtaaatagccgt
gacataacaatcacatcaccttcatacagagtggacataataacaagacaggatatagcg
gaagagatagccagaatgtacggatataacaacatccctacgactctgcctaaaattgat
gccgactcaatgcctatgcagccattacttgccacacgcaggtttctggcacagaagctc
aaaaccctcggtttcaatgaagctatcaactattcatttatgaaagctgattttcttaag
ctgtttgacagtgaggagaagtttgtaaaactcataaatcctatatctgaagacatgaat
accatgcgtacacaggttttcccaggccttctggcaacgataagatacaacctgaacaac
ggattcaaacaagcacgtttctttgagtttgcatcaagtttcatcaaaactgaagacaaa
cttcctgaacagagaatgcttctggcggctgcttcagctggagacttctgggacgtaagc
tgggccgctccaaagggaacagaacctttctttatgatgaagggagttcttgaaaatctc
ctcgcacaatacaaaatcaaggctgaatttacaaaaagcagcaggcattttctgcaccca
ggtaagtcggcagaagttatagttaacggcaaaagcataggctttatcggagagcttcac
cctttaacagcagaagctgccgaacttcgcgaacgtgtgacattctttgaaattgacatg
caggattttgtagataatgctgagtttgtattcaaatttgaatctttcagtaagttccct
tcagtatacaaagacatatctgttattgtcgacacagacacaccaacagaaaagctgact
gagtgcataaaaaataccagcaaacttgctgaagacgtgtcactttacgacgtctataca
ggaaaaggtattgaagaagggaaagcaagccgaacattccgtgtgctcttcacagccggc
gacagaacccttacagacgaggagacaaacggtatccttcagaagatgattgataacctt
gtaaaagactatggagcacaactcagataa

DBGET integrated database retrieval system