KEGG   Denitrovibrio acetiphilus: Dacet_1964Help
Entry
Dacet_1964        CDS       T01189                                 

Definition
phenylalanyl-tRNA synthetase subunit beta
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:dap00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2067602..2069971
Genome map
AA seq 789 aa AA seqDB search
MKVSLNWLNKFVEVADLDPNDIAEKLTMCGLEVDAVEHLAPLDNVVVAKVKSCVKHPDAD
KLSLCEVFDGTETYQVVCGAPNVAEGQTIVFAKIGAVLPGNFKIKKAKIRGTESSGMICA
EDEIGLSENHDGIMVLDDSLEPGMPVNELFGLPDTVLEIGITPNRADCLSIIGYAHEIAA
LYNRKLKKNEYKLNETDEPAGNYGGVEIKNKKACPTYLGRVIKDVTIKPSPLWMQNRLRA
VGVRPISNVVDITNYVLFEYGQPLHTFDLKEIDGRIIIRNAENGEKLITLDEKERVFNEN
MLLITDEKKSLAIAGVMGGEHSGISKDTKDVFLECAYFEPKQTRMTARKLGMQTDASYRY
ERGIDPVNTKEMCEYAAYLIQELCGGKVCKGVLGEVNDPEPITFTVNADWINSYLGTDVS
LDQMVQILDGLNMNPVVNSRDITITSPSYRVDIITRQDIAEEIARMYGYNNIPTTLPKID
ADSMPMQPLLATRRFLAQKLKTLGFNEAINYSFMKADFLKLFDSEEKFVKLINPISEDMN
TMRTQVFPGLLATIRYNLNNGFKQARFFEFASSFIKTEDKLPEQRMLLAAASAGDFWDVS
WAAPKGTEPFFMMKGVLENLLAQYKIKAEFTKSSRHFLHPGKSAEVIVNGKSIGFIGELH
PLTAEAAELRERVTFFEIDMQDFVDNAEFVFKFESFSKFPSVYKDISVIVDTDTPTEKLT
ECIKNTSKLAEDVSLYDVYTGKGIEEGKASRTFRVLFTAGDRTLTDEETNGILQKMIDNL
VKDYGAQLR
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagtttaaactggttaaataaatttgtagaagtagccgaccttgaccctaat
gatatagctgagaagctcaccatgtgcggtctggaagttgatgctgttgaacacctcgcc
cccctcgacaatgtggttgttgcgaaggtcaaatcatgtgtaaagcatccggatgccgac
aagctttctctctgcgaagtcttcgacggaacagaaacttatcaggttgtatgcggtgca
ccaaatgttgcagaaggtcagacaatagtatttgcaaagataggcgctgtcctgccgggt
aatttcaaaatcaaaaaagccaaaatcagaggaacagaatcttcgggtatgatatgtgca
gaagatgagatcggactttcagaaaatcatgacggaataatggttctggatgactctctc
gaaccgggaatgcccgtaaacgagcttttcggactgccggatactgtactggaaataggt
atcacacctaaccgcgcagattgcctgagcatcataggctatgcccatgagattgcagcc
ctctataaccgtaaactcaaaaaaaatgagtacaaactaaacgaaacagacgagcctgcc
ggtaattacggcggtgttgaaataaaaaataaaaaagcgtgccctacttatctggggcgt
gtcatcaaagatgtaactatcaaaccatctccgctctggatgcagaacagactgcgtgcc
gtgggggtacgtcccatcagcaacgttgtagacattacaaactatgtgctgttcgagtac
ggccagcctctgcacactttcgacctgaaagagatagatggcaggatcatcatccgtaac
gctgaaaatggtgaaaaattgattacgcttgatgagaaagaacgtgtattcaacgaaaac
atgctccttatcacagacgaaaaaaaatctcttgcgatagctggtgttatgggtggagaa
cactcagggatcagcaaagacacaaaagatgtctttcttgagtgtgcatacttcgagccg
aaacagacacgcatgacagcaagaaaactcggcatgcagacagatgcttcatatcgctac
gaaaggggcattgacccggttaacacaaaagagatgtgcgaatacgcagcatatcttatt
caggagctatgcggagggaaagtatgcaaaggcgttctgggtgaggttaacgaccccgag
ccaataacattcactgtaaatgcagactggattaacagctacctggggacagacgtctcc
cttgaccagatggtgcagatactggatggtctgaacatgaaccctgttgtaaatagccgt
gacataacaatcacatcaccttcatacagagtggacataataacaagacaggatatagcg
gaagagatagccagaatgtacggatataacaacatccctacgactctgcctaaaattgat
gccgactcaatgcctatgcagccattacttgccacacgcaggtttctggcacagaagctc
aaaaccctcggtttcaatgaagctatcaactattcatttatgaaagctgattttcttaag
ctgtttgacagtgaggagaagtttgtaaaactcataaatcctatatctgaagacatgaat
accatgcgtacacaggttttcccaggccttctggcaacgataagatacaacctgaacaac
ggattcaaacaagcacgtttctttgagtttgcatcaagtttcatcaaaactgaagacaaa
cttcctgaacagagaatgcttctggcggctgcttcagctggagacttctgggacgtaagc
tgggccgctccaaagggaacagaacctttctttatgatgaagggagttcttgaaaatctc
ctcgcacaatacaaaatcaaggctgaatttacaaaaagcagcaggcattttctgcaccca
ggtaagtcggcagaagttatagttaacggcaaaagcataggctttatcggagagcttcac
cctttaacagcagaagctgccgaacttcgcgaacgtgtgacattctttgaaattgacatg
caggattttgtagataatgctgagtttgtattcaaatttgaatctttcagtaagttccct
tcagtatacaaagacatatctgttattgtcgacacagacacaccaacagaaaagctgact
gagtgcataaaaaataccagcaaacttgctgaagacgtgtcactttacgacgtctataca
ggaaaaggtattgaagaagggaaagcaagccgaacattccgtgtgctcttcacagccggc
gacagaacccttacagacgaggagacaaacggtatccttcagaagatgattgataacctt
gtaaaagactatggagcacaactcagataa

DBGET integrated database retrieval system