KEGG   Denitrovibrio acetiphilus: Dacet_1997Help
Entry
Dacet_1997        CDS       T01189                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
dap  Denitrovibrio acetiphilus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dacet_1997
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dacet_1997
   00650 Butanoate metabolism
    Dacet_1997
  Energy metabolism
   00190 Oxidative phosphorylation
    Dacet_1997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2105254..2105562
Genome map
AA seq 102 aa AA seqDB search
MNNYKYMGASDSGTVGWLMQRVSGAILILVVFVHFFSMIKGGSAGMMQIITGPAAAFGVF
HTFNGFKMITDDYVPSEGWRGVIYGAYWICAITLVILAVKVM
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaataactacaaatatatgggtgccagtgattctggtacagtcggatggcttatgcaa
agggtttcaggtgctatcctgattctcgttgtgttcgtacactttttctccatgatcaaa
ggcggaagcgctggtatgatgcagatcatcacaggtcctgccgctgcttttggtgtattt
cacacatttaacggctttaaaatgataaccgacgactatgtccccagtgaaggctggaga
ggcgtgatatacggcgcttactggatatgcgctatcacactcgtgattctcgccgttaag
gtaatgtaa

DBGET integrated database retrieval system