KEGG   Denitrovibrio acetiphilus: Dacet_1997Help
Entry
Dacet_1997        CDS       T01189                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00020  Citrate cycle (TCA cycle)
dap00190  Oxidative phosphorylation
dap00650  Butanoate metabolism
dap01100  Metabolic pathways
dap01110  Biosynthesis of secondary metabolites
dap01120  Microbial metabolism in diverse environments
dap01130  Biosynthesis of antibiotics
dap01200  Carbon metabolism
Module
dap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dap_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dacet_1997
   00650 Butanoate metabolism
    Dacet_1997
  Energy metabolism
   00190 Oxidative phosphorylation
    Dacet_1997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADD68760
UniProt: D4H1K0
Position
2105254..2105562
Genome map
AA seq 102 aa AA seqDB search
MNNYKYMGASDSGTVGWLMQRVSGAILILVVFVHFFSMIKGGSAGMMQIITGPAAAFGVF
HTFNGFKMITDDYVPSEGWRGVIYGAYWICAITLVILAVKVM
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaataactacaaatatatgggtgccagtgattctggtacagtcggatggcttatgcaa
agggtttcaggtgctatcctgattctcgttgtgttcgtacactttttctccatgatcaaa
ggcggaagcgctggtatgatgcagatcatcacaggtcctgccgctgcttttggtgtattt
cacacatttaacggctttaaaatgataaccgacgactatgtccccagtgaaggctggaga
ggcgtgatatacggcgcttactggatatgcgctatcacactcgtgattctcgccgttaag
gtaatgtaa

DBGET integrated database retrieval system