KEGG   Denitrovibrio acetiphilus: Dacet_2113Help
Entry
Dacet_2113        CDS       T01189                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dacet_2113
Enzymes [BR:dap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Dacet_2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2238064..2238708
Genome map
AA seq 214 aa AA seqDB search
MLLLKERKLLVEYGKKLVTTNLTSGTGGNLSIYNRDENLVAVTPSGVDYMKTTVEDIVIT
DIDGNVVEGDNRPTSELSFHLSLYKDRADVCAVVHTHSVYATTVACLGMELPAVHYMVGY
SGSKVPLAPYCTFGSPELAESIIEHIGGYNAVLLANHGLVTVSGNMPTAFAAAEEIEFVA
RIFCQAKSIGSPIILDDVEMETVVEKFKWYGKKK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttttaaaagagagaaaacttcttgtggaatacggtaagaaactggtcacaacg
aacctgaccagcggaaccggcggaaacctgagcatatacaacagagacgaaaatctggtt
gcagtcacaccttcaggggtagactacatgaaaacaaccgtggaagacattgtaatcacc
gacatagacggtaacgttgttgagggagataacagaccgacaagcgaactctcctttcac
ctcagtctttacaaggacagggcagacgtttgtgctgttgtgcatactcattcggtctat
gccacaaccgttgcctgtctggggatggaactacctgctgtacactatatggtgggctac
agcggcagtaaagttcccctcgctccatactgcacattcggctctccggagctcgcagaa
agcatcatagaacacataggcggttataatgctgtgctcctcgccaaccacggtcttgtg
actgtgtcgggcaatatgccaacagcttttgcagcagcagaagagatagagtttgtggca
cgtatcttctgtcaggcaaagagtataggcagcccaatcatacttgacgacgtagagatg
gaaaccgtcgttgagaaatttaaatggtatgggaaaaagaaataa

DBGET integrated database retrieval system