KEGG   Denitrovibrio acetiphilus: Dacet_2206Help
Entry
Dacet_2206        CDS       T01189                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dap00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dap00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2335349..2336803)
Genome map
AA seq 484 aa AA seqDB search
MKVSQLLDGLSIKGFDLDVDFETDVKDINIDSRNIKRKAPFFAFQGAAVDSHKFAAEVYA
SGKVPFVVAEHKIEGVPTVVVEDGRKALARACRNFFGKPDEEMDSIAVTGTNGKTTTTYI
INEILKTAGRKSVLVGTTGVKYDDKFIYMDSTTPPTYEFFKVLRDAKDAGCDTLVMEVSS
HALHQHRINGVVFDVAIFTNLSGDHLDYHKTMDEYFEAKKILFTPEYSRVGVIGKDSEFG
ERLLKEAEVDRVSYGITNKSEITAEEIWFGLSGLRAKFVYPAGSIEMESSLVGLHNLENL
MAAGSGCIMLGIDAKHIKSGIERLKNVPGRLEKFEKSNGAYIFVDFAHTDDALKNVLEAL
GSFKENRVITVFGCGGDRDRSKRPRMAKTAELDSDVVIVTSDNPRTEDPQQVIEDILVGF
ENADSVIICPDRSKAIQKAVEMAEPKDIVLIAGKGHEDYMILGTEKIHFDDREEVKKHLE
VSEC
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctcccagcttcttgacggactttccatcaagggtttcgatctggacgtggat
tttgaaactgatgtgaaagatatcaacattgacagtagaaacattaagagaaaggcgccg
ttttttgcctttcagggtgctgctgtggattcgcacaaattcgctgctgaagtttatgcg
agcggtaaagtaccgtttgttgtcgccgagcataagattgaaggagtgcctacagtcgta
gtcgaagacgggagaaaagcacttgcccgtgcctgccgcaattttttcggcaagccggac
gaagagatggactccatcgctgtaactggtacaaacggaaaaacaacaacgacttatatt
ataaatgaaatactaaagacagcaggacgcaagtccgttttggtggggacaactggggtt
aagtacgatgataaatttatttatatggattccacaactcctcccacatatgagtttttt
aaagtattaagagatgcaaaagatgcagggtgcgacactctggtgatggaagtttcgtcc
cacgctctgcaccagcacagaataaacggtgtggtttttgatgtagctatatttacaaac
ctttccggcgaccatcttgattaccacaagactatggatgaatactttgaggcgaagaaa
attctttttactcctgagtattcccgtgttggcgttataggtaaagatagtgagtttggt
gaaagactgctgaaagaagctgaggtggatagagtatcttacgggattacaaataaatct
gagataacagcagaggagatatggttcgggctttcaggtctgcgggcaaaattcgtttat
cctgcgggcagtattgaaatggaatcatcacttgtcgggctacataaccttgaaaacctt
atggctgccggttccggatgcataatgcttggtattgacgcaaagcatataaaaagtggt
attgaacgcctcaaaaatgttcccgggagacttgaaaagtttgaaaagtcaaacggtgcg
tatatatttgttgattttgcccatacagacgatgcccttaagaacgttctggaagctcta
gggagctttaaggaaaacagggtgataactgtgttcggctgcggcggagacagggacaga
agcaaaagaccaaggatggcaaaaaccgctgaacttgattcagacgtggtaatagttacc
agcgacaatccaaggacagaagacccgcaacaggtcatcgaagacatacttgtagggttt
gaaaatgcagacagtgttatcatctgtccggatcggagcaaagccatacagaaggctgtt
gagatggctgaaccaaaggacatagtcctgatagcgggaaaaggtcatgaggattatatg
atcctcggaacagaaaagattcacttcgacgacagagaagaagtgaagaaacatctggag
gtaagtgaatgctag

DBGET integrated database retrieval system