KEGG   Denitrovibrio acetiphilus: Dacet_2345Help
Entry
Dacet_2345        CDS       T01189                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dacet_2345
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dacet_2345
   00640 Propanoate metabolism
    Dacet_2345
   00660 C5-Branched dibasic acid metabolism
    Dacet_2345
Enzymes [BR:dap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dacet_2345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2480464..2481678)
Genome map
AA seq 404 aa AA seqDB search
MNLHEFQAKGLLRTYGVPVPDGGVASTASDALRVAKELHSDRWVIKAQVHAGGRGKAGGV
KVVDVFSDLYDLSANMLGMKIVTKQTGDEGKIVRRILVEKATDIKQEIYVSFLVDRDSEQ
HMIIASSEGGVEIEQVAAKTPEKVIKERINPVTGMGQFLGRKIAKKMGLDSSLLNKFADV
TNKLYQCFIDHDGMMLEINPLVVTGSGDIVCLDAKMSVDENALFRHRAIEEMKDYGELEP
QEVRASIFDLSYVSMEGNIGCMVNGAGLAMATMDIIKSYGGQPANFLDVGGGADVNKVRE
AFKIILTDPKVKVIFVNIFGGIVRCDLIAQGVLKASEEVPGDRYIVVRLDGTNVEEGKKI
LEDGASKSGLNIVTGDTMADAAEKAVKLAEEAENKKKTPRNKAK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatttcaggccaaaggcctactcaggacatacggcgttcccgtccct
gacggtggtgtagcatccactgcgagcgacgcactccgtgtagctaaagaacttcacagt
gaccgatgggtgataaaggctcaagttcacgcagggggaagaggaaaggctggtggcgtc
aaagttgttgatgtcttcagcgatctttatgatctttcagccaacatgcttggtatgaag
atcgtcaccaaacagaccggagatgagggcaaaattgtccgcaggattctggttgaaaaa
gctacagacattaaacaggaaatatacgtgagtttcctggtggacagagattctgagcag
cacatgataatagcaagctcagaaggcggtgttgagattgagcaggtagctgcgaaaaca
ccggaaaaagttataaaagagcgcattaatcctgtgacggggatggggcagtttctcgga
agaaaaattgccaaaaagatggggctggattcttcactcctcaataaattcgcagatgtt
acaaacaaattataccagtgttttattgatcatgacggtatgatgcttgaaatcaatcct
ctggttgttacaggcagtggggacatagtttgtctcgacgccaagatgtcagttgacgaa
aacgcacttttcagacacagagcgatagaagagatgaaagattatggtgagctcgagccg
caagaagttcgcgccagtatctttgatctctcttatgtcagtatggaaggcaatatcggc
tgtatggttaacggagccggacttgcaatggctactatggacatcataaaatcatatggc
ggacagcctgccaacttccttgatgtagggggtggtgcagatgtcaacaaagtacgtgaa
gcattcaaaattatccttacagacccaaaagttaaggtgatttttgtaaatatattcggc
ggtattgtccgctgtgacctcatagctcagggtgtacttaaggcctctgaagaagttccg
ggagacaggtacatcgttgtcagactcgatggaacgaatgtcgaagaaggcaaaaagatt
ctggaagacggcgcgagtaagagcggtctgaacattgttaccggcgacactatggcagat
gcggctgaaaaagctgtaaaacttgctgaagaagctgaaaacaaaaagaaaacacccaga
aacaaggctaaataa

DBGET integrated database retrieval system