KEGG   Denitrovibrio acetiphilus: Dacet_2371Help
Entry
Dacet_2371        CDS       T01189                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dap  Denitrovibrio acetiphilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dacet_2371
DNA repair and recombination proteins [BR:dap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dacet_2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2507785..2508378
Genome map
AA seq 197 aa AA seqDB search
MKNRIFERCVGELSRLPGIGRKTAARLALHILKADSEQVKSLAESLVELKEKTVFCKICG
NMSETEVCHICTDGYRNRSQICVVEEAKDIYVLEATGFFRGLYHVLGGRISPLDGIGPED
LHIEELLKRAKAEDVSEIILATNPDIEGETTAIYLSKLLKKQNLKVTKIASGVPIGTNLE
YTDEITLLKAMEQRKDF
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaggatctttgagcgctgcgttggcgagctctcaaggctccccggtataggc
agaaagaccgccgcaaggcttgccctgcatatactgaaagctgacagcgaacaggtgaaa
tccctcgcagaaagccttgtggagcttaaggagaagaccgtcttctgtaaaatatgcgga
aatatgtccgagacagaagtctgccatatatgcactgacggctaccgtaacaggagccag
atatgcgttgtggaagaggcgaaggatatctatgtgctggaagcaacaggcttcttcaga
gggctttatcacgtcctcggtgggcgcatatcccccctcgacggcataggaccggaagac
cttcacattgaagaactgctgaaaagagcaaaagctgaagatgtttctgagattatactc
gctaccaaccccgacatcgaaggggaaaccacagccatatacctctcaaaactactcaaa
aaacagaacctgaaagtgaccaaaatagccagcggagtgccgataggtacaaatctggaa
tacaccgacgagataacattgcttaaagcgatggaacagagaaaagatttttaa

DBGET integrated database retrieval system