KEGG   Denitrovibrio acetiphilus: Dacet_2455Help
Entry
Dacet_2455        CDS       T01189                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dacet_2455
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dacet_2455
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dacet_2455
Enzymes [BR:dap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dacet_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2586935..2588308)
Genome map
AA seq 457 aa AA seqDB search
MNYISTRGQKGKVSFKDAVMMGLAEDGGLLLPESVPSVADKLDELAKLSYNELAYEIISL
FAADIPETDLRTLIEKSYSSFTTPEVAPVVKKGGIYIQELFHGPTFAFKDVALQLLGNLF
EYILKERSEKLNIIGATSGDTGSAAIYGVRGKDNINIFILHPKGRVSAVQEMQMTSVTDD
NVFNLAIEGTFDDAQDIVKAAFGDIAYKKRYKLGAVNSINWARVLAQIVYYFYGYFQAKK
QGAQKVRFVVPTGNFGNIFAGYFAKMMGLPLDKMILATNENNILSRFINNGDYSKKDVVQ
TYSPSMDIQIASNFERYLYFLCDRDSKALSEKMAELKTSGRISFSSDEMRNVHAEFATFS
TSNELTEKTIKEFYDKTGYVLDPHTACGVSAALSMADADYICLSTAHPAKFPDVVEKATG
LAPEKPEGIAKLENLDKKCITIENDLERVKDFVAKHV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatcagcacaagaggacaaaaaggaaaggtctctttcaaagatgccgtcatg
atggggcttgctgaagacggaggattactcctccctgaaagcgtgccttctgttgcagac
aaattggatgaactggcgaagctcagttataatgagctggcttatgagattatatcgctg
tttgctgccgacatccctgaaactgacctcagaacgctgatagaaaagagttattcgtca
tttacaactccggaagttgcacctgttgtcaaaaagggcggcatatatattcaggaactt
ttccacggccccacattcgcatttaaggatgtggctcttcagcttttagggaatcttttt
gagtacatactcaaggaacgttccgaaaaacttaatatcatcggcgcaacatccggtgac
acaggttccgctgccatttacggtgtccgcggaaaggacaatattaatatatttatactg
caccctaaagggcgtgtcagcgctgttcaggagatgcagatgacatctgttacagacgat
aacgtctttaaccttgccattgaagggacttttgatgatgctcaggatatcgtaaaagct
gcattcggtgacatcgcttataagaagagatataagctcggtgctgtgaattctatcaac
tgggcaagggttctggcgcagatagtctattacttttacggatattttcaggcgaaaaag
cagggcgcacagaaggtacgttttgtcgtgcccacaggaaacttcggcaatatatttgcc
ggatatttcgcaaaaatgatggggctcccccttgataaaatgatactcgccacaaacgaa
aataatatactttccagatttataaataacggcgactacagtaaaaaggatgttgtacag
acctatagtccgtctatggatatacagattgcttcgaactttgaaaggtatctgtatttt
ctttgtgacagggacagcaaagccctcagcgaaaagatggcggagctcaaaaccagcggc
agaatatctttttcatccgatgagatgagaaatgttcacgcagaatttgcaacattttca
acatcaaatgaattgacagagaaaacaattaaggaattttacgataaaacaggctatgtg
ctggatcctcatactgcctgtggtgtttcagccgctctcagtatggctgatgcggattat
atttgtctttccactgcacatccggctaaatttcctgatgtggttgaaaaagccacaggg
ctggcaccggagaaaccagaggggatagcgaaacttgagaatcttgataaaaagtgtatc
accatcgaaaatgatctggaaagggtgaaagacttcgttgcaaaacatgtctga

DBGET integrated database retrieval system