KEGG   Denitrovibrio acetiphilus: Dacet_2512Help
Entry
Dacet_2512        CDS       T01189                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dacet_2512
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dacet_2512
Enzymes [BR:dap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dacet_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2654584..2655072
Genome map
AA seq 162 aa AA seqDB search
MSLLNFEIPLVTGEMKNLDEYSGKVVLAVNTASKCGFTPQYEGLEEIYRMYKDQGFVVLA
FPCNQFGAQEPGTEEEIHEFLSCNYTITFPVFQKIDVNGANQHPFFRALKTMAPGTMGTK
PIKWNFTKFLISRDGTRVERFASSKDPEKLRTAIERELAKEA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtcactactgaattttgaaataccacttgttacaggcgagatgaaaaatctggatgaa
tacagcgggaaagttgttctggctgttaataccgcaagcaaatgcggattcaccccgcaa
tatgaagggctggaagaaatctaccggatgtataaagatcaggggtttgttgtgctagca
tttccatgtaaccagttcggcgcacaggaaccgggtacagaagaggagattcacgaattt
cttagctgtaactacactataacattccctgttttccagaaaattgatgttaacggagca
aatcagcacccgtttttccgtgcgcttaaaactatggcgccgggtactatgggcacgaaa
cctataaaatggaattttacaaagtttctgatcagcagagacggcacaagggtggagcgg
tttgcatcttccaaagaccctgaaaaacttagaacagccatagaaagagagcttgcgaaa
gaagcctag

DBGET integrated database retrieval system