KEGG   Denitrovibrio acetiphilus: Dacet_2512Help
Entry
Dacet_2512        CDS       T01189                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dap00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dap00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2654584..2655072
Genome map
AA seq 162 aa AA seqDB search
MSLLNFEIPLVTGEMKNLDEYSGKVVLAVNTASKCGFTPQYEGLEEIYRMYKDQGFVVLA
FPCNQFGAQEPGTEEEIHEFLSCNYTITFPVFQKIDVNGANQHPFFRALKTMAPGTMGTK
PIKWNFTKFLISRDGTRVERFASSKDPEKLRTAIERELAKEA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtcactactgaattttgaaataccacttgttacaggcgagatgaaaaatctggatgaa
tacagcgggaaagttgttctggctgttaataccgcaagcaaatgcggattcaccccgcaa
tatgaagggctggaagaaatctaccggatgtataaagatcaggggtttgttgtgctagca
tttccatgtaaccagttcggcgcacaggaaccgggtacagaagaggagattcacgaattt
cttagctgtaactacactataacattccctgttttccagaaaattgatgttaacggagca
aatcagcacccgtttttccgtgcgcttaaaactatggcgccgggtactatgggcacgaaa
cctataaaatggaattttacaaagtttctgatcagcagagacggcacaagggtggagcgg
tttgcatcttccaaagaccctgaaaaacttagaacagccatagaaagagagcttgcgaaa
gaagcctag

DBGET integrated database retrieval system