KEGG   Denitrovibrio acetiphilus: Dacet_2598Help
Entry
Dacet_2598        CDS       T01189                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dap00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2762553..2763413
Genome map
AA seq 286 aa AA seqDB search
MNEILNFHGDDVTPSAPEEAYFHVIPVPYEQTVSFGVGTAEGPEAILKTSAQLETFDSKS
IPAELGIYTAPPVDCTGAIKDTLLNITSAVNSTLQMDKTPVVLGGEHTVTYGVIEALYKK
YGKDFCVVQFDAHADLRDSYDGTKFSHACVMKRIFDLDIPFYQLGTRSYSIEEHNLRLRH
NIHFMDAEELCSGGDETFVLPPYFPKNIFITFDIDALDAAIMPATGTPVPGGLGWYQSLK
LIEKALSGRKCIGFDVVEFSPIEGFHGYDFTAAQLVYNIMGIIHRS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaattttaaactttcacggtgacgatgtaacaccttctgctccagaggaagca
tactttcacgtaatccctgtaccctacgaacaaactgtatcttttggcgtgggtactgct
gaaggaccggaggcaatccttaaaacttcggcacagctcgaaacattcgacagcaaatca
atacctgccgagctggggatatataccgctccccctgttgactgcacaggagcaataaaa
gatactctgctgaacataacatccgctgtaaacagtacgctgcaaatggacaaaacacca
gtggttctgggcggagagcacaccgtaacatatggagtgattgaagcattatataagaag
tacggaaaagatttctgcgtggtacagttcgatgcacatgctgacctccgggactcatat
gatggcacaaaattcagccacgcatgcgtgatgaagcgcatatttgatctggatatccct
ttttatcagctgggcacaaggagctacagcatagaggaacacaacctccgtctgcgccac
aacatacactttatggatgcggaagagctctgctccggcggtgacgaaacattcgtactc
ccgccgtattttccgaaaaatatattcataacattcgacatagatgcactcgatgctgct
ataatgccggcaactggaacccctgttcccggaggactgggctggtatcaatcgctgaaa
ctcatagaaaaagcactgagcggacgaaaatgcataggatttgacgttgtggaattctcc
cctatagaaggatttcacgggtatgacttcactgcggcacagcttgtctacaacatcatg
ggtattatccacagatcctaa

DBGET integrated database retrieval system