KEGG   Denitrovibrio acetiphilus: Dacet_2752Help
Entry
Dacet_2752        CDS       T01189                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dap  Denitrovibrio acetiphilus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dap00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2928579..2929403
Genome map
AA seq 274 aa AA seqDB search
MSYDERLLHEVINIALQAGREIMRIYQMDFSVQYKGDNSPLTDADMRSNAIIIDGLRKLD
KQYPILSEEAKFAAYAERKNWKNFWLVDPIDGTKEVIKKNGEFTVNIALIEEKLPVLGVV
YAPALDTLYYGMKGFGAFRKTGGRLEKLPTEKNDPLTSKTIKVAVSRSHMNKETSDFIDR
LSRNYPDCRIETISKGSSLKLCMVAEGSADIYPRIAPTMEWDTAAAHGVVKASGKGTYKL
DSFTVDEDIFHKKIIAERLVYNKDDLLNPFFIVI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagttatgacgaaagacttcttcacgaagtaataaacatcgctcttcaggctggcaga
gaaattatgcggatttaccaaatggatttctctgttcagtataaaggtgacaactcgccg
cttacagatgcggatatgcgctccaacgctattataattgacggactgagaaaactggac
aaacagtaccccatcctctcagaagaagccaagttcgcggcatacgccgagaggaaaaac
tggaaaaacttctggctggttgaccccattgacggaacgaaagaggtcatcaagaagaac
ggagaattcaccgtaaatatagctctcatcgaagagaagttgcctgttttgggtgttgtc
tatgctcccgctcttgatacactttattacggtatgaaaggctttggagctttcaggaaa
acaggcggcagacttgaaaaactgccaactgaaaagaatgaccctctgacaagcaaaacc
ataaaagttgcggtttcccgttctcatatgaacaaagagacctcagacttcatagacaga
ctttccagaaattaccctgactgccgtattgaaaccatttccaaaggcagttcactgaaa
ctctgcatggtggcggaaggttctgctgatatatacccgagaatcgcccccacaatggag
tgggacaccgctgccgctcatggtgttgttaaagcttcagggaaaggcacatacaaactc
gactcttttactgtggatgaagacatcttccataaaaaaatcattgctgaaagattagta
tacaataaagatgatttactgaatccgttttttattgttatttag

DBGET integrated database retrieval system