KEGG   Denitrovibrio acetiphilus: Dacet_2978Help
Entry
Dacet_2978        CDS       T01189                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00010  Glycolysis / Gluconeogenesis
dap00051  Fructose and mannose metabolism
dap00562  Inositol phosphate metabolism
dap01100  Metabolic pathways
dap01110  Biosynthesis of secondary metabolites
dap01120  Microbial metabolism in diverse environments
dap01130  Biosynthesis of antibiotics
dap01200  Carbon metabolism
dap01230  Biosynthesis of amino acids
Module
dap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dap_M00002  Glycolysis, core module involving three-carbon compounds
dap_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dacet_2978
   00051 Fructose and mannose metabolism
    Dacet_2978
   00562 Inositol phosphate metabolism
    Dacet_2978
Enzymes [BR:dap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dacet_2978
Exosome [BR:dap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dacet_2978
  Exosomal proteins of bladder cancer cells
   Dacet_2978
  Exosomal proteins of melanoma cells
   Dacet_2978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF533
Motif
Other DBs
NCBI-ProteinID: ADD69728
UniProt: D4H724
Position
3177649..3178410
Genome map
AA seq 253 aa AA seqDB search
MRKPYIYGNWKMNLDMHGSSDLISSILSVKIDYTKVDVGVAPDFSSLYKVSQTIKQMGYP
ISVAAQNISAEEKGAFTGDVSAAMVFAAGADSTILGHSERRMIFAEGDELINQKVKTALR
NNLDVILCVGETLDERESGVAADRVVYQVGMGLKDIGMDRINRVTLAYEPVWAIGTGKTA
TPADAEDIHGKIRTQLSKMYGPVVAEKIRILYGGSVKPDNVSALMMRENIDGALVGGASL
DATSFAKLVNFNG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagccatacatctacggcaactggaagatgaatctggatatgcatggatccagc
gatcttataagttctatattgtcagttaaaatagattatacaaaagtagatgttggtgtt
gcgcctgacttcagttctctgtataaagtgagccagaccatcaaacagatgggatatcct
atttcggtcgctgcgcagaatatttccgcagaagaaaagggtgcgtttacaggagatgta
agtgctgctatggtgtttgccgctggagcagatagtacgatactcgggcactctgagagg
cggatgatatttgcagagggggacgagcttattaaccaaaaagttaaaacagctcttcgc
aataaccttgatgttatcctctgtgtaggcgaaacacttgatgaacgggagagcggcgtt
gctgcggatcgcgttgtctatcaggtgggaatggggcttaaggatattggcatggacaga
ataaaccgtgttaccctcgcctatgaaccggtctgggctatcggtactggtaagaccgca
acccctgctgatgccgaagatatccacgggaaaatccgtacgcagctttctaagatgtac
gggcctgttgtcgctgaaaagatcagaatactatacggaggcagcgtgaaaccggataat
gtttcggctctcatgatgcgcgaaaatatagatggcgcccttgttggcggagccagcctt
gatgcaacttcatttgcaaagctggtaaattttaacggataa

DBGET integrated database retrieval system