KEGG   Dechloromonas aromatica: Daro_0151Help
Entry
Daro_0151         CDS       T00259                                 

Definition
phosphoglycerate/bisphosphoglycerate mutase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
dar  Dechloromonas aromatica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Daro_0151
Enzymes [BR:dar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Daro_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
165225..165782
Genome map
AA seq 185 aa AA seqDB search
MLHHPHDSPFVSKITMRLHLIRHPKPMIDAGICYGRHDCPALDVLSVAAALLRELPSGLP
VWSSPLRRCRALAEQLHARPIIDERLAEMDFGRWEGRRWDDIPRAELDAWAADVAGYAPP
GGESPRQLQQRALGLVDSLAVPEVVIVTHAGVIRTLLAHWQGLPPERWTELNFAYGSCTV
IDIPR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctccaccatcctcacgatagtccattcgtttcgaaaatcacaatgcgccttcatctg
attcgacatcccaagcccatgatcgacgccggcatctgctatggccgacatgattgcccg
gccctggatgtgctgtcagtggccgctgccttgctgcgcgaactgccgtccgggttgcca
gtgtggagcagtcccttgcgccgctgtcgagccttggcggagcaactgcacgcgcggccg
atcatcgacgagcgcttggccgagatggatttcggccgctgggagggacggcgctgggac
gatatcccacgggccgaactggatgcctgggccgccgatgtggccggctatgctccgccg
ggcggggaatcaccacgtcagttgcagcagcgggccctgggcttggttgattcgctggct
gtgcctgaggtggtgatcgtcacccatgccggggtgatccgcaccttgctggcgcactgg
caggggttgccgccggagcgctggacggaactgaacttcgcttatggttcctgcacggtg
atcgacatcccccggtaa

DBGET integrated database retrieval system